KEGG   Staphylococcus aureus subsp. aureus ST228/10388 (MRSA): SAI1T1_2015630Help
Entry
SAI1T1_2015630    CDS       T03143                                 

Gene name
aldA
Definition
(GenBank) Aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saut  Staphylococcus aureus subsp. aureus ST228/10388 (MRSA)
Pathway
saut00010  Glycolysis / Gluconeogenesis
saut00053  Ascorbate and aldarate metabolism
saut00071  Fatty acid degradation
saut00280  Valine, leucine and isoleucine degradation
saut00310  Lysine degradation
saut00330  Arginine and proline metabolism
saut00340  Histidine metabolism
saut00380  Tryptophan metabolism
saut00410  beta-Alanine metabolism
saut00561  Glycerolipid metabolism
saut00620  Pyruvate metabolism
saut00625  Chloroalkane and chloroalkene degradation
saut01100  Metabolic pathways
saut01110  Biosynthesis of secondary metabolites
saut01120  Microbial metabolism in diverse environments
saut01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI1T1_2015630 (aldA)
   00053 Ascorbate and aldarate metabolism
    SAI1T1_2015630 (aldA)
   00620 Pyruvate metabolism
    SAI1T1_2015630 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI1T1_2015630 (aldA)
   00561 Glycerolipid metabolism
    SAI1T1_2015630 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI1T1_2015630 (aldA)
   00310 Lysine degradation
    SAI1T1_2015630 (aldA)
   00330 Arginine and proline metabolism
    SAI1T1_2015630 (aldA)
   00340 Histidine metabolism
    SAI1T1_2015630 (aldA)
   00380 Tryptophan metabolism
    SAI1T1_2015630 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI1T1_2015630 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI1T1_2015630 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI1T1_2015630 (aldA)
Enzymes [BR:saut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI1T1_2015630 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCJ11481
LinkDB All DBs
Structure
PDB: 

Position
complement(2122364..2123791)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system