KEGG   Staphylococcus aureus subsp. aureus ST228/10388 (MRSA): SAI1T1_2017890Help
Entry
SAI1T1_2017890    CDS       T03143                                 

Definition
(GenBank) ABC transporter (Periplasmic amino acid-binding protein)
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
saut  Staphylococcus aureus subsp. aureus ST228/10388 (MRSA)
Pathway
saut02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:saut00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAI1T1_2017890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saut02000]
    SAI1T1_2017890
   02035 Bacterial motility proteins [BR:saut02035]
    SAI1T1_2017890
Transporters [BR:saut02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    SAI1T1_2017890
Bacterial motility proteins [BR:saut02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    SAI1T1_2017890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 SspK
Motif
Other DBs
NCBI-ProteinID: CCJ11699
LinkDB All DBs
Position
complement(2420765..2421544)
Genome map
AA seq 259 aa AA seqDB search
MKRLLFVMIAFVFILAACGNNSSKDKEANKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgtggaaac
aattcgtcgaaagacaaggaagctaataaagatagcaagacaattaatgttggtactgag
gggacttatgcaccatttagtttccatgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag

DBGET integrated database retrieval system