KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_0149Help
Entry
SA957_0149        CDS       T02850                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Pathway
sauu00010  Glycolysis / Gluconeogenesis
sauu00053  Ascorbate and aldarate metabolism
sauu00071  Fatty acid degradation
sauu00280  Valine, leucine and isoleucine degradation
sauu00310  Lysine degradation
sauu00330  Arginine and proline metabolism
sauu00340  Histidine metabolism
sauu00380  Tryptophan metabolism
sauu00410  beta-Alanine metabolism
sauu00561  Glycerolipid metabolism
sauu00620  Pyruvate metabolism
sauu00625  Chloroalkane and chloroalkene degradation
sauu01100  Metabolic pathways
sauu01110  Biosynthesis of secondary metabolites
sauu01120  Microbial metabolism in diverse environments
sauu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA957_0149
   00053 Ascorbate and aldarate metabolism
    SA957_0149
   00620 Pyruvate metabolism
    SA957_0149
  Lipid metabolism
   00071 Fatty acid degradation
    SA957_0149
   00561 Glycerolipid metabolism
    SA957_0149
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA957_0149
   00310 Lysine degradation
    SA957_0149
   00330 Arginine and proline metabolism
    SA957_0149
   00340 Histidine metabolism
    SA957_0149
   00380 Tryptophan metabolism
    SA957_0149
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SA957_0149
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SA957_0149
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SA957_0149
Enzymes [BR:sauu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SA957_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGW32648
LinkDB All DBs
Position
175489..176976
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVEVAQ
EAFETWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgccgtcgaagtggcgcaa
gaggcatttgaaacatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaagcatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gacccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgtttaactgaaaatgggttagataaaggattcttctttgaaccgacattaattgctgtg
ccagataatcatcataaattagcgcaagaagaaatatttggaccagttttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattcagagtatggtttagct
ggcggcgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgttcgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system