KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_0687Help
Entry
SA957_0687        CDS       T02850                                 

Gene name
rir2
Definition
(GenBank) ribonucleoside-diphosphate reductase beta chain
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Pathway
sauu00230  Purine metabolism
sauu00240  Pyrimidine metabolism
sauu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SA957_0687 (rir2)
   00240 Pyrimidine metabolism
    SA957_0687 (rir2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sauu03400]
    SA957_0687 (rir2)
Enzymes [BR:sauu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     SA957_0687 (rir2)
DNA repair and recombination proteins [BR:sauu03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SA957_0687 (rir2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-ProteinID: AGW33186
LinkDB All DBs
Position
777906..778877
Genome map
AA seq 323 aa AA seqDB search
MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGL
DTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWV
LEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGK
MTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYT
KMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNPIIENALDTTTKNHDFFSVK
GDGYVLALNVEALQDDDFVFDNK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgttaattggaacacacaagaagatatgacgaatatgttttggagacaaaat
atatctcaaatgtgggttgaaacagaatttaaagtatcaaaagacattgcaagttggaag
actttatctgaagctgaacaagacacatttaaaaaagcattagctggtttaacaggctta
gatacacatcaagcagatgatggtatgcctttagttatgctacatacgactgacttaagg
aaaaaagcagtttattcatttatggcgatgatggagcaaatacacgcgaaaagctattca
catattttcacaacactattaccatctagtgaaacaaactacttattagatgaatgggtt
ttagaggaacctcatttaaaatataaatctgataaaattgttgctaattatcacaaactt
tggggtaaagaagcttcgatatacgaccaatatatggccagagttacgagtgtattttta
gaaacattcttattcttctcaggtttctattatccactatatctagctggtcaaggaaaa
atgacgacatcaggtgaaatcattcgtaaaattcttttagatgaatctattcatggtgta
tttaccggtttagatgcacagcatttacgaaatgaactatctgaaagtgagaaacaaaaa
gcagaccaagaaatgtataaattgctaaatgacttgtatttaaatgaagagtcatacaca
aaaatgttatacgatgatcttggaatcactgaagatgtgctaaactatgttaaatataat
ggaaacaaagcactttcaaacttaggctttgaaccttattttgaggaacgtgaatttaac
ccaatcattgagaatgccttagatacaacaactaaaaaccatgacttcttctcagtaaaa
ggtgatggttatgtattagcattaaacgtagaagcattacaagatgatgactttgtattt
gacaacaaataa

DBGET integrated database retrieval system