KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_1108Help
Entry
SA957_1108        CDS       T02850                                 

Gene name
pknB
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sauu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sauu01001]
    SA957_1108 (pknB)
Enzymes [BR:sauu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SA957_1108 (pknB)
Protein kinases [BR:sauu01001]
 Serine/threonine kinases: Other
  Bacterial family
   SA957_1108 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 Sigma_reg_N Choline_kinase Kinase-like Kdo ETRAMP Spore_permease PNPase
Motif
Other DBs
NCBI-ProteinID: AGW33605
LinkDB All DBs
Structure
PDB: 

Position
1210884..1212878
Genome map
AA seq 664 aa AA seqDB search
MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGMLYEPKPKKKSTRKIVLLSLIFSLLM
IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
YDDI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaaataataaatgaacgatataaaattgtagataagcttggcggcggtggc
atgagtaccgtttatcttgcagaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatattgaaggtccgactttgtctgagtatatagaa
agtcatgggccattaagtgttgacacggcgattaattttacgaatcaaatattggatggc
attaaacatgcacatgatatgcgtattgtacatagagatattaagccacaaaatatatta
attgacagcaataaaacgttgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcgccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccatttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgcgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtagtgttttacatgaaaatcgagcgaatgaagacgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggcctgctcatcatcagcaattccaaaagccagaaggtatgttgtatgaaccaaaa
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaatctgtaaaagaagcagagcaaatattcaataaaaataatctgaaa
ttaggtaaaatttctagaagttatagtgataaatatcctgaaaatgaaattattaagaca
acccctaatacaggtgaacgtgttgaacgtggtgacagtgttgatgttgttatatcaaaa
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagccttacag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagca
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgaa
cataaatcctttagcaaagctaaaaaagccttagaagaaaaaggatttaaagttgaaagt
aaagaagagtatagcgacgatattgatgagggtgatgtaatttctcaatctccaaaaggg
aaatcagtagatgaggggtcaacgatttcgtttgttgtttctaaaggtaaaaaaagcgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgacattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagtagacggtaaaactgtagctgaaaaagaagtcagc
tatgatgatatttaa

DBGET integrated database retrieval system