KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_1188Help
Entry
SA957_1188        CDS       T02850                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Pathway
sauu00564  Glycerophospholipid metabolism
sauu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sauu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SA957_1188 (glpD)
Enzymes [BR:sauu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SA957_1188 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox Lycopene_cycl NAD_binding_8 FAD_oxidored Thi4 GIDA 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGW33685
LinkDB All DBs
Position
1307206..1308879
Genome map
AA seq 557 aa AA seqDB search
MALSTFKREYIKKNLRNDEYDLVIIGGGITGAGIALDASERGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYVEYRTDDARLTIEVMKR
AAEKGAEIINYTKSEHFTYDKNQQVNGVTVIDKLTNENYTIKAKKVVNAAGPWVDDVRSG
DYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAIPREGKAYVGTTDTFYD
NIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPLIYEEGKDPSEISRKDE
IWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSPCNTKGLAISGGDVGGS
KNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQTSQYHDSKLPLEIYVEL
VYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDSIIDIMADMLDYSPAQIEAYTEEVE
QAIKEAQHGNNQPAVKE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtctacttttaagagagaatatattaaaaagaatttaagaaatgatgaatat
gatttagtaattattggtggcggtattacaggtgcaggtattgcactagacgcgagtgaa
agaggaatgaaagttgcattagttgaaatgcaagactttgcacaaggaacaagctcaaga
tctacaaaattagtccatggtggtttacgttacttaaaacaattccaaattggagtagtt
gccgaaactggtaaagaacgtgcgattgtttatgaaaatgggcctcatgttacgactcca
gagtggatgcttttaccaatgcataaaggtggaacatttggtaaattctcaacatcaatt
ggtttaggaatgtatgatcgtttagcaggtgttaaaaagtctgaacgtaaaaaaatgtta
tctaaaaaagaaactttagctaaagaaccattagttaaaaaagaaggtctaaaaggcggc
ggttactatgttgaatatcgtactgacgatgcgcgtttaactattgaagttatgaagcgt
gctgctgaaaaaggcgcagaaattatcaactatactaagtcagaacacttcacttatgat
aaaaatcaacaagtaaatggtgttacagttatagataaattaactaatgaaaattataca
attaaggctaaaaaagtggttaatgcagcaggtccatgggttgatgatgttagaagtggt
gattatgcacgcaataataaaaaattacgtttaactaaaggtgtacatgttgttattgat
caatcaaaattcccattaggtcaagcagtatactttgatactgaaaaagatggaagaatg
atttttgcaatcccgcgtgaaggaaaagcgtatgtaggtactacagatacattctatgac
aatatcaaatcttcaccattaactacacaagaagacagagactatttaatcgatgctatt
aattacatgttccctagtgttaatgttacagatgaagatattgaatcaacatgggcagga
attagaccattaatttacgaagaaggcaaagacccttctgaaatctctcgtaaggatgaa
atttgggaaggtaaatcaggtttattaactattgcaggtggtaaattaacaggctatcgt
cacatggctcaagacattgttgatttagtatctaaacgcttgaaaaaagactacggttta
acatttagtccatgtaatacaaaaggtctggcaatttcaggtggcgatgtaggtggtagt
aagaactttgatgcgtttgtagagcaaaaagtagatgtagctaaaggattcggcattgat
gaagatgttgcaagacgtttagcatctaaatatggttcaaatgttgatgaattgttcaac
attgcgcaaacatctcaataccatgatagcaagttaccattagaaatttatgtagaactt
gtttatagtattcaacaagaaatggtatacaaacctaacgatttcttagttcgtcgttct
ggtaaaatgtacttcaatattaaagatgtattagattataaagatagtatcatagatatt
atggctgatatgttagactactctccagctcaaattgaggcttatactgaagaagttgag
caagcaattaaagaagcgcaacatggaaataatcaaccagcagttaaagaataa

DBGET integrated database retrieval system