KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_1277Help
Entry
SA957_1277        CDS       T02850                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Pathway
sauu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sauu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SA957_1277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sauu02000]
    SA957_1277
Enzymes [BR:sauu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SA957_1277
Transporters [BR:sauu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SA957_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 Rad17 AAA_15 AAA_22 RsgA_GTPase AAA_23 AAA_29 AAA_10 RNA_helicase AAA_30 AAA_28 PRK AAA_18 Viral_helicase1 G-alpha AAA_14 AAA_16 AAA_24 Adeno_IVa2 PhoH AAA_PrkA AAA ATPase_2 AAA_33 AAA_5
Motif
Other DBs
NCBI-ProteinID: AGW33774
LinkDB All DBs
Position
complement(1398776..1399627)
Genome map
AA seq 283 aa AA seqDB search
MAQTLAQTKQISQSHTFDVSQSHHKTPNDTNSHSVIYSTQNLDLWYGENHALQNINLDIY
ENQITAIIGPSGCGKSTYIKTLNRMVELVPTVKTAGKILYRDQDIFDQKYSKEQLRTNVG
MVFQQPNPFPKSIYDNITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAYSL
SGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQ
AARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYISGRFG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaacacttgcacaaactaaacaaatttctcaaagtcatacgtttgatgtctca
caaagtcatcataaaacaccaaatgatacaaactcacattctgttatatattcaacacaa
aatttagacttatggtatggcgaaaatcatgcattgcaaaatattaatttagatatttat
gaaaaccaaattactgccattataggtccatctggttgtggcaaatcaacatatattaaa
actttgaatcgaatggttgagttagtacccacagtcaaaacagctggtaaaatattatat
cgcgatcaagacatttttgatcaaaaatattctaaagaacaattacgtacaaatgtgggc
atggtctttcaacaacctaatccatttccaaaatcaatatacgataatattacttacggt
ccaaagattcacggtattaaaaataaaaaagttcttgatgaaatcgttgagaaatcatta
cgtggcgctgcaatttgggatgaattaaaggataggttgcacacaaatgcatatagttta
tccggtgggcaacaacagcgtgtttgtatcgcgcgttgtttagcaattgaacctgaagtc
attttaatggatgaaccgacatcagcattagatccaatctcaacattaagagtagaagag
ttggttcaagaactaaaagaaaagtatacaattattatggttacacataatatgcaacaa
gcagctcgagtatcagataaaactgcctttttcttaaatggttatgtcaatgaatatgat
gacactgataaaattttctctaacccatcaaacaagaaaacagaagattatatttcagga
aggtttggttga

DBGET integrated database retrieval system