KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_1924Help
Entry
SA957_1924        CDS       T02850                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Pathway
sauu00473  D-Alanine metabolism
sauu00550  Peptidoglycan biosynthesis
sauu01100  Metabolic pathways
sauu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sauu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SA957_1924
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SA957_1924
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SA957_1924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sauu01011]
    SA957_1924
Enzymes [BR:sauu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SA957_1924
Peptidoglycan biosynthesis and degradation proteins [BR:sauu01011]
 Precursor biosynthesis
  Amino acid ligase
   SA957_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGW34419
LinkDB All DBs
Structure
PDB: 

Position
complement(2106605..2107675)
Genome map
AA seq 356 aa AA seqDB search
MTKENICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITTEIK
STDELHLENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNG
VLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDKLNYPVFVKPAN
LGSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVLGNDYPEATWPGEVV
KDVAFYDYKSKYKDGKVQLQIPADLDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDN
QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIELAKERHQDKQKNKYKID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggagggaaaagtgcagaacacgaagtatcg
attctgacagcacaaaatgtattaaatgcaatagataaagacaaatatcatgttgatatc
atttatattaccaatgatggtgattggagaaagcaaaataatattacaactgaaattaaa
tctactgatgagcttcatttagaaaatggagaggcgcttgagatttcacagctattgaaa
gaaagtagttcaggacaaccatacgatgcagtattcccattattacatggtcctaatggt
gaagatggcacgattcaaggactttttgaagttttggatgtaccatatgtaggaaatggt
gtattgtcagctgcaagttctatggacaaacttgtaatgaaacaattatttgaacatcga
gggttaccacagttaccttatattagtttcttacgttctgaatatgaaaaatatgaacat
aacattttaaaattagtaaatgataaattaaattacccagtctttgttaaacctgctaac
ttagggtcaagtgtaggtatcagtaaatgtaataatgaagcggaacttaaagaaggtatt
aaagaagcattccaatttgaccgtaagcttgttattgaacaaggcgttaacgcacgtgaa
attgaagtagcagttttaggaaatgactatcctgaagcgacatggccaggtgaagtcgta
aaagatgtcgcgttttacgattacaaatcaaaatataaagatggtaaggttcaattacaa
attccagctgacttagacgaagatgttcaattaacgcttagaaatatggcattagaggca
ttcaaagcgacagattgttctggtttagtccgtgctgatttctttgtaacagaagacaac
caaatatatattaatgaaacaaatgcaatgcctggatttacggctttcagtatgtatcca
aagttatgggaaaatatgggcttatcttatccagaattgattacaaaacttatcgagctt
gctaaagaacgtcaccaggataaacagaaaaataaatacaaaattgactaa

DBGET integrated database retrieval system