KEGG   Staphylococcus aureus subsp. aureus ST228/18412 (MRSA): SAI7S6_1001900Help
Entry
SAI7S6_1001900    CDS       T03147                                 

Gene name
gutB
Definition
(GenBank) L-iditol=2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sauv  Staphylococcus aureus subsp. aureus ST228/18412 (MRSA)
Pathway
sauv00040  Pentose and glucuronate interconversions
sauv00051  Fructose and mannose metabolism
sauv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAI7S6_1001900 (gutB)
   00051 Fructose and mannose metabolism
    SAI7S6_1001900 (gutB)
Enzymes [BR:sauv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAI7S6_1001900 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD NAD_binding_3 ADH_N_2 UDPG_MGDP_dh_N TrkA_N adh_short_C2 CHASE4
Motif
Other DBs
NCBI-ProteinID: CCJ21956
LinkDB All DBs
Position
265839..266903
Genome map
AA seq 354 aa AA seqDB search
MFVVKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVT
LGHEFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDG
AFTNYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLL
VAQVLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVV
ECSGAVPAARQGLDIIRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEP
SLQLMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtggtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttctt
gataaagaagttgcaacaccgctagatgataaagtaaagattaaagtacattatgcagga
atttgtggcacagacattcatacttatgaagggcattataaagttaattttccagtgaca
ttaggtcatgaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaa
gttggtgaccgtgtcacttctgaaactacattctatgtttgtaatgagtgtgaatactgt
aaatcaaaagactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggc
gcatttactaattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagta
tcgtatcagtctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaag
attcaagtgaactctggcgatgtagcagttgtaatgggacctgggccaatcggattactt
gtagcacaagtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgac
aaagtcagattagataaagcagaagcattgcacatggattatgtagtcaatttacaacaa
acagacttaaaaacgtatatcaatggaattacagacggttacggtgcagatgttgttgtt
gaatgttcaggtgcagttccagcagcacgacaaggtttagatattatacgcaaaaaaggt
ttctacagtcaaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtg
attcaaaaagaaataacagttgttggtagtagaagtcaaaagccagcagattgggaacct
tcattgcaacttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatat
gatatttcgaaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagca
ttacttaagccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system