KEGG   Staphylococcus aureus subsp. aureus ST228/18412 (MRSA): SAI7S6_1017910Help
Entry
SAI7S6_1017910    CDS       T03147                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sauv  Staphylococcus aureus subsp. aureus ST228/18412 (MRSA)
Pathway
sauv00010  Glycolysis / Gluconeogenesis
sauv00260  Glycine, serine and threonine metabolism
sauv00680  Methane metabolism
sauv01100  Metabolic pathways
sauv01110  Biosynthesis of secondary metabolites
sauv01120  Microbial metabolism in diverse environments
sauv01130  Biosynthesis of antibiotics
sauv01200  Carbon metabolism
sauv01230  Biosynthesis of amino acids
Module
sauv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sauv_M00002  Glycolysis, core module involving three-carbon compounds
sauv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sauv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI7S6_1017910 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAI7S6_1017910 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAI7S6_1017910 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sauv04131]
    SAI7S6_1017910 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauv04147]
    SAI7S6_1017910 (gpmA)
Enzymes [BR:sauv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAI7S6_1017910 (gpmA)
Membrane trafficking [BR:sauv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAI7S6_1017910 (gpmA)
Exosome [BR:sauv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAI7S6_1017910 (gpmA)
  Exosomal proteins of melanoma cells
   SAI7S6_1017910 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCJ23490
LinkDB All DBs
Position
complement(2423285..2423971)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system