KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1001190Help
Entry
SAI5S5_1001190    CDS       T03148                                 

Definition
(GenBank) Putative aldehyde dehydrogenase AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00010  Glycolysis / Gluconeogenesis
sauw00053  Ascorbate and aldarate metabolism
sauw00071  Fatty acid degradation
sauw00280  Valine, leucine and isoleucine degradation
sauw00310  Lysine degradation
sauw00330  Arginine and proline metabolism
sauw00340  Histidine metabolism
sauw00380  Tryptophan metabolism
sauw00410  beta-Alanine metabolism
sauw00561  Glycerolipid metabolism
sauw00620  Pyruvate metabolism
sauw00625  Chloroalkane and chloroalkene degradation
sauw01100  Metabolic pathways
sauw01110  Biosynthesis of secondary metabolites
sauw01120  Microbial metabolism in diverse environments
sauw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI5S5_1001190
   00053 Ascorbate and aldarate metabolism
    SAI5S5_1001190
   00620 Pyruvate metabolism
    SAI5S5_1001190
  Lipid metabolism
   00071 Fatty acid degradation
    SAI5S5_1001190
   00561 Glycerolipid metabolism
    SAI5S5_1001190
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI5S5_1001190
   00310 Lysine degradation
    SAI5S5_1001190
   00330 Arginine and proline metabolism
    SAI5S5_1001190
   00340 Histidine metabolism
    SAI5S5_1001190
   00380 Tryptophan metabolism
    SAI5S5_1001190
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI5S5_1001190
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI5S5_1001190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI5S5_1001190
Enzymes [BR:sauw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI5S5_1001190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CCJ17958
LinkDB All DBs
Position
161028..162515
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system