KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1002860Help
Entry
SAI5S5_1002860    CDS       T03148                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAI5S5_1002860 (ahpF)
Enzymes [BR:sauw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAI5S5_1002860 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like Thi4 FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_9 NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CCJ18125
LinkDB All DBs
Position
complement(396226..397749)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLKQLLELMEGNVEFVASLGSDEKSKELKELLTEISDMSPRLSLSEKSLKRT
PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKNLEGSFHFE
TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
MSTGEEHLLNLDGIFVQIGLLPNTSWLKDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaaacaacaacttaaacaattattagaactaatggagggcaac
gttgaattcgttgccagccttggttcagatgaaaaatctaaggaactcaaagaattatta
acagaaatttctgatatgtcacctagactttcactttctgaaaagtctttaaaacgtaca
ccaagtttctcagtcaaccgtcctggcgaagaaacaggtgtaacatttgcaggaattcca
ttaggtcacgagtttaactcacttgttttagcaattttacaggttagtggtcgtgcacct
aaagaaaaacagtcaattattgaccaaattaaaaacttagaaggttcattccattttgaa
acattcattagtttaacgtgtcaaaaatgtcctgatgtcgttcaagcacttaacttaatg
agtgtgatcaaccctaacatcacgcattctatgattgatggtgcagtgttccgtgaagaa
tctgaaaacatcatggcagtccctgctgtctttttaaacggcgaagaatttggcaatggt
cgtatgacaatccaagatattctttcgaaactaggcagtacggcagatgcatctgagttt
gaaaataaagaaccttatgatgtcttaatcgttggtggtggtcctgctagtggtagtgca
gcgatttacacagcacgtaaaggtttacgtactggtatagttgctgatcgtatcggtggc
caagttaatgatactgctggtattgagaacttcattactgttaaagaaacaactggttct
gaattttcttctaacttagcagcgcacattgatcaatatgacattgatgcaatgacaggt
atacgtgctacagatatcgaaaagactgacgaagcaattaaagttacgttagaaaacggt
gctgtcttagaaagtaaaacagtcattattgctactggtgcaggttggcgtaagctaaac
attccaggtgaagagcaattgattaataaaggtgttgcattctgccctcactgtgacgga
cctctattcgaaaataaagacgtagcagttatcggtggcggtaactctggggttgaagca
gcaattgaccttgctggtatcgttaatcatgttacattattcgaattcgctagcgaatta
aaagcagacaacgtgttacaagatcgtttacgttctttatcaaatgttgatatcaaaaca
aatgccaaaactactgaagttgtcggagaagaccatgttacaggtatacgttacgaagac
atgagcaccggcgaagaacatctacttaacttagatggtatctttgttcaaattggttta
cttccaaacacatcatggttaaaagatgctgttgaattaaacgaacgtggtgaaattgtt
attgatcgtaacaataatactaacgtacctggaatatttgctgctggcgatgtcacagat
cagaagaacaaacaaattatcatttcaatgggcgctggtgcaaatgcagcattaaatgcc
tttgactatattatcagaaactaa

DBGET integrated database retrieval system