KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1015560Help
Entry
SAI5S5_1015560    CDS       T03148                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00240  Pyrimidine metabolism
sauw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAI5S5_1015560 (tdk)
Enzymes [BR:sauw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SAI5S5_1015560 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_19
Motif
Other DBs
NCBI-ProteinID: CCJ19336
LinkDB All DBs
Structure
PDB: 

Position
complement(2119420..2120019)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHNLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggatagaatgtattacaggtagtatgtttagcggt
aaatccgaagaactaataagacgtctaagaaggggtatatacgctaaacaaaaagtcgtt
gtatttaaaccggcgattgatgatcgatatcataaagaaaaagtggtctctcataatggt
aatgccattgaagcgattaatatttctaaagcaagtgaaattatgacgcacaacttaact
aatgttgatgttataggaatagacgaagtgcaattttttgacgatgaaattgtaagtata
gtagaaaaactatcagcagatggacaccgtgttattgttgctggattagatatggatttt
aggggcgaaccgttcgaaccaatgcctaaattgatggctgtcagtgaacaagtaacgaaa
cttcaagcagtttgtgctgtttgtggttcttcatctagtagaacgcaacgattaataaat
ggtaaaccagctaaaatcgatgatccgattatcttagtaggtgccaatgaaagttatgag
ccacgttgtcgcgcgcaccatatcgtagcacctagtgataataataaggaggaattataa

DBGET integrated database retrieval system