KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1015580Help
Entry
SAI5S5_1015580    CDS       T03148                                 

Definition
(GenBank) Putative aldehyde dehydrogenase SA1924
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00010  Glycolysis / Gluconeogenesis
sauw00053  Ascorbate and aldarate metabolism
sauw00071  Fatty acid degradation
sauw00280  Valine, leucine and isoleucine degradation
sauw00310  Lysine degradation
sauw00330  Arginine and proline metabolism
sauw00340  Histidine metabolism
sauw00380  Tryptophan metabolism
sauw00410  beta-Alanine metabolism
sauw00561  Glycerolipid metabolism
sauw00620  Pyruvate metabolism
sauw00625  Chloroalkane and chloroalkene degradation
sauw01100  Metabolic pathways
sauw01110  Biosynthesis of secondary metabolites
sauw01120  Microbial metabolism in diverse environments
sauw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI5S5_1015580
   00053 Ascorbate and aldarate metabolism
    SAI5S5_1015580
   00620 Pyruvate metabolism
    SAI5S5_1015580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI5S5_1015580
   00561 Glycerolipid metabolism
    SAI5S5_1015580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI5S5_1015580
   00310 Lysine degradation
    SAI5S5_1015580
   00330 Arginine and proline metabolism
    SAI5S5_1015580
   00340 Histidine metabolism
    SAI5S5_1015580
   00380 Tryptophan metabolism
    SAI5S5_1015580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI5S5_1015580
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI5S5_1015580
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI5S5_1015580
Enzymes [BR:sauw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI5S5_1015580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCJ19338
LinkDB All DBs
Structure
PDB: 

Position
complement(2122301..2123728)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system