KEGG   Staphylococcus aureus subsp. aureus ST228/18341 (MRSA): SAI6T6_1015590Help
Entry
SAI6T6_1015590    CDS       T03149                                 

Definition
(GenBank) Putative aldehyde dehydrogenase SA1924
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saux  Staphylococcus aureus subsp. aureus ST228/18341 (MRSA)
Pathway
saux00010  Glycolysis / Gluconeogenesis
saux00053  Ascorbate and aldarate metabolism
saux00071  Fatty acid degradation
saux00280  Valine, leucine and isoleucine degradation
saux00310  Lysine degradation
saux00330  Arginine and proline metabolism
saux00340  Histidine metabolism
saux00380  Tryptophan metabolism
saux00410  beta-Alanine metabolism
saux00561  Glycerolipid metabolism
saux00620  Pyruvate metabolism
saux00625  Chloroalkane and chloroalkene degradation
saux01100  Metabolic pathways
saux01110  Biosynthesis of secondary metabolites
saux01120  Microbial metabolism in diverse environments
saux01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI6T6_1015590
   00053 Ascorbate and aldarate metabolism
    SAI6T6_1015590
   00620 Pyruvate metabolism
    SAI6T6_1015590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI6T6_1015590
   00561 Glycerolipid metabolism
    SAI6T6_1015590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI6T6_1015590
   00310 Lysine degradation
    SAI6T6_1015590
   00330 Arginine and proline metabolism
    SAI6T6_1015590
   00340 Histidine metabolism
    SAI6T6_1015590
   00380 Tryptophan metabolism
    SAI6T6_1015590
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI6T6_1015590
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI6T6_1015590
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI6T6_1015590
Enzymes [BR:saux01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI6T6_1015590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCJ21302
LinkDB All DBs
Structure
PDB: 

Position
complement(2122350..2123777)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system