KEGG   Staphylococcus aureus subsp. aureus ST228/18583 (MRSA): SAI8T7_1007790Help
Entry
SAI8T7_1007790    CDS       T03150                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sauy  Staphylococcus aureus subsp. aureus ST228/18583 (MRSA)
Pathway
sauy00010  Glycolysis / Gluconeogenesis
sauy00020  Citrate cycle (TCA cycle)
sauy00620  Pyruvate metabolism
sauy01100  Metabolic pathways
sauy01110  Biosynthesis of secondary metabolites
sauy01120  Microbial metabolism in diverse environments
sauy01130  Biosynthesis of antibiotics
sauy01200  Carbon metabolism
Module
sauy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sauy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI8T7_1007790 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SAI8T7_1007790 (pdhC)
   00620 Pyruvate metabolism
    SAI8T7_1007790 (pdhC)
Enzymes [BR:sauy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAI8T7_1007790 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 ATP-synt_ab_Xtn HlyD_D23 DUF2090 DUF896 HTH_17 NRIP1_repr_3
Motif
Other DBs
NCBI-ProteinID: CCJ24494
LinkDB All DBs
Position
1051447..1052739
Genome map
AA seq 430 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
EVAETPAAPAAVSLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
NNPELLLMEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatactattgaagaagacgatgttttagctgaggtacaa
aacgataaatcagtagtagaaatcccatcaccagtatctggtactgtagaagaagttatg
gtagaagaaggtacagtagctgtagttggtgacgttattgttaaaatcgatgcacctgat
gcagaagatatgcaatttaaaggtcatgatgatgattcatcatctaaagaagaacctgcg
aaagaggaagcgccagcagagcaagcacctgtagctactcaaactgaagaagtagatgaa
aacagaactgttaaagcaatgccttcagtacgtaaatacgcacgtgaaaaaggtgttaac
attaaagcagtttctggatctggtaaaaatggtcgtattacaaaagaagatgtagatgca
tacttaaatggtggtgcaccaacagcttcaaatgaatcagctgcttcagctacaagtgaa
gaagttgctgaaactcctgcagcacctgcagcagtatcattagaaggcgacttcccagaa
acaactgaaaaaatccctgctatgcgtagagcaattgcgaaagcaatggttaactctaag
catactgcacctcatgtaacattaatggatgaaattgatgttcaagcattatgggatcac
cgtaagaaatttaaagaaatcgcagctgaacaaggtactaagttaacattcttaccttat
gttgttaaagcacttgtttctgcattgaaaaaatacccagcacttaacacttcattcaat
gaagaagctggtgaaattgtgcataaacattattggaatatcggtattgcggcggacact
gatagaggtttattagtacctgtagtgaaacatgctgatcgtaagtctattttccaaatt
tcagatgaaattaatgaattagctgttaaagcacgtgatggtaaattaacagccgatgaa
atgaaaggtgcaacatgcacaatcagtaatatcggttcagctggtggacaatggttcact
ccagttatcaatcacccagaagtagcaatcttaggaattggccgtattgctcaaaaacct
atcgttaaagatggagaaattgttgcagcaccagtattagcattatcattaagctttgac
cacagacaaattgatggtgcaactggccaaaatgcaatgaatcacattaaacgtttatta
aataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system