KEGG   Staphylococcus aureus subsp. aureus ST228/18583 (MRSA): SAI8T7_1017890Help
Entry
SAI8T7_1017890    CDS       T03150                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sauy  Staphylococcus aureus subsp. aureus ST228/18583 (MRSA)
Pathway
sauy00010  Glycolysis / Gluconeogenesis
sauy00260  Glycine, serine and threonine metabolism
sauy00680  Methane metabolism
sauy01100  Metabolic pathways
sauy01110  Biosynthesis of secondary metabolites
sauy01120  Microbial metabolism in diverse environments
sauy01130  Biosynthesis of antibiotics
sauy01200  Carbon metabolism
sauy01230  Biosynthesis of amino acids
Module
sauy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sauy_M00002  Glycolysis, core module involving three-carbon compounds
sauy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sauy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI8T7_1017890 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAI8T7_1017890 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAI8T7_1017890 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sauy04131]
    SAI8T7_1017890 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauy04147]
    SAI8T7_1017890 (gpmA)
Enzymes [BR:sauy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAI8T7_1017890 (gpmA)
Membrane trafficking [BR:sauy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAI8T7_1017890 (gpmA)
Exosome [BR:sauy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAI8T7_1017890 (gpmA)
  Exosomal proteins of melanoma cells
   SAI8T7_1017890 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCJ25456
LinkDB All DBs
Position
complement(2423338..2424024)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system