KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_0250Help
Entry
SAZ172_0250       CDS       T02886                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00040  Pentose and glucuronate interconversions
sauz00051  Fructose and mannose metabolism
sauz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAZ172_0250
   00051 Fructose and mannose metabolism
    SAZ172_0250
Enzymes [BR:sauz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAZ172_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD NAD_binding_3 UDPG_MGDP_dh_N TrkA_N adh_short ADH_N_2 3HCDH_N 2-Hacid_dh_C CHASE4 Pyr_redox TFIIS_C
Motif
Other DBs
NCBI-ProteinID: AGY88351
UniProt: A0A0E1AET4
LinkDB All DBs
Position
292427..293482
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAAICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECGYCESKDYNLCNHRKGIGTQVDGAFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGSGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEITFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcagcaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacttctgaaacgacattctatgtttgtaatgagtgtggatactgtgaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagtgtcgtatcag
tctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaagattcaagtc
aattcaggcgatgtagcagttgtaatgggatctgggccaatcggattacttgtagcacaa
gtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggatacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattacatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccggcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagcattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system