KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_0864Help
Entry
SAZ172_0864       CDS       T02886                                 

Definition
(GenBank) Hypothetical protein
  KO
K07090  uncharacterized protein
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAZ172_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF5592
Motif
Other DBs
NCBI-ProteinID: AGY88964
UniProt: A0A0E1AIL3
LinkDB All DBs
Position
935320..936147
Genome map
AA seq 275 aa AA seqDB search
MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLHNITTQVAIGTSSVIL
IVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLTFESFNLYFGIFLIFVA
ILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFITTFLIGILTGLFGIGGG
ALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGHVAWGYAIILIISSYFGAK
IGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttattaacaattacattattagttttaatcggaggtttgtcagcgattatagggtct
atcgtaggcattggaggcggtattattatcgttccaacaatggtttacctcggtgttgaa
catggattactacataatattacaacacaagtagcgatagggacgtcttcagtcattcta
attgtgacaggactttcttcatcacttggatatttaaaaacaaaacaagttgatattaaa
aatggttccatctttttatttggactattaccaggttcattgcttgggtccttcattagt
agatatttaacatttgagtcatttaatttatattttggtatctttttaattttcgtagcc
attttattaatggtaagaaataagattaaaccgtttaaaattttcgataaacccaagtat
gaaaagacttatgtagacgctaaaggtaaaacatatcattatagtgttccaccattgttt
gcttttattacaacgtttttaattggtatattgacaggtttatttggtattggaggtggc
gcactaatgacgccactaatgcttattgtatttagatttccacctcatgtagctgttgga
acaagtatgatgatgattttcttttcaagtgtcatgagttctatagggcacattgctcaa
ggtcacgtagcttggggttatgcaatcattttaattatttctagttattttggtgcgaaa
atcggtgtcaaagtgaatcaatcaattaagtcagatacggtagtaacattattgagaaca
gtaatgttgttaatgggtatatatttaattattcgtgcgttgatttaa

DBGET integrated database retrieval system