KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_0952Help
Entry
SAZ172_0952       CDS       T02886                                 

Gene name
fabI
Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00061  Fatty acid biosynthesis
sauz00780  Biotin metabolism
sauz01100  Metabolic pathways
sauz01130  Biosynthesis of antibiotics
sauz01212  Fatty acid metabolism
Module
sauz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAZ172_0952 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAZ172_0952 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAZ172_0952 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sauz01004]
    SAZ172_0952 (fabI)
Enzymes [BR:sauz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAZ172_0952 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAZ172_0952 (fabI)
Lipid biosynthesis proteins [BR:sauz01004]
 Fatty acid synthase
  Component type
   SAZ172_0952 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGY89052
UniProt: A0A0E1AEV9
LinkDB All DBs
Structure
PDB: 

Position
1029209..1029979
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcttgaaaacaaaacatatgtcatcatgggaatcgctaataagcgtagtatt
gcttttggtgtcgctaaagttttagatcaattaggtgctaaattagtatttacttaccgt
aaagaacgtagccgtaaagagcttgaaaaattattagaacaattaaatcaaccagaagcg
cacttatatcaaattgatgttcaaagcgatgaagaggttattaatggttttgagcaaatt
ggtaaagatgttggcaatattgatggtgtatatcattcaatcgcatttgctaatatggaa
gacttacgcggacgcttttctgaaacttcacgtgaaggcttcttgttagctcaagacatt
agttcttactcattaacaattgtggctcatgaagctaaaaaattaatgccagaaggtggt
agcattgttgcaacaacatatttaggtggcgaattcgcagttcaaaactataatgtgatg
ggtgttgctaaagcgagcttagaagcaaatgttaaatatttagcattagacttaggtcca
gataatattcgcgttaatgcaatttcagctggtccaatccgtacattaagtgcaaaaggt
gtgggtggtttcaatacaattcttaaagaaatcgaagagcgtgcacctttaaaacgtaat
gttgatcaagtagaagtaggtaaaactgcggcttacttattaagtgatttatcaagtggc
gttacaggtgaaaatattcatgtagatagcggattccacgcaattaaataa

DBGET integrated database retrieval system