KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_1224
Entry
SAZ172_1224       CDS       T02886                                 

Gene name
pknB
Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sauz01001]
    SAZ172_1224 (pknB)
Enzymes [BR:sauz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SAZ172_1224 (pknB)
Protein kinases [BR:sauz01001]
 Serine/threonine kinases: Other
  Bacterial family
   SAZ172_1224 (pknB)
SSDB
Motif
Pfam: Pkinase PASTA PK_Tyr_Ser-Thr APH Pkinase_fungal Seadorna_VP7 RIO1 Sigma_reg_N ChlamPMP_M Kinase-like Choline_kinase ETRAMP Kdo PNPase
Other DBs
NCBI-ProteinID: AGY89324
LinkDB
Structure
PDB: 
3PY9 3M9G 4EQM

Position
1290534..1292528
AA seq 664 aa
MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESRGPLSVDTAINFTNQILDG
IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
YDDV
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgataggtaaaataataaatgaacgatataaaattgtagataagcttggcggcggtggc
atgagtaccgtttatcttgctgaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatatcgaaggtccgactttgtctgagtatattgaa
agtcgtgggccattaagtgttgacacagcgattaattttacgaatcaaatattggatggc
attaaacatgcgcatgatatgcgtattgtacatagagatattaagccacaaaatatatta
attgacagcaataaaacgttgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcgccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccctttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgcgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtagtgttttacatgaaaatcgagcgaatgaagatgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggcctgctcatcatcagcaattccaaaagccagaaggtacggtgtacgaaccaaaa
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaatctgtaaaagaagcagagcaaatattcaataaaaacaacctgaaa
ttgggtaaaatttctagaagttatagtgataaatatcctgaaaatgaaattattaagaca
actcctaatactggtgaacgtgttgaacgtggtgacagtgttgatgttgttatatcaaag
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagccttgcag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagcg
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgaa
cataaatcctttagcaaagctaaaaaagccttagaagaaaaagggtttaaagttgaaagt
aaggaagagtatagtgacgatattgatgagggtgatgtgatttctcaatctcctaaagga
aaatcagtagatgaggggtcaacgatttcatttgttgtttctaaaggtaaaaaaagtgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgatattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagttgacggtaaaactgtagctgaaaaagaagtcagc
tatgatgatgtataa

DBGET integrated database retrieval system