KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_2226Help
Entry
SAZ172_2226       CDS       T02886                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00010  Glycolysis / Gluconeogenesis
sauz00053  Ascorbate and aldarate metabolism
sauz00071  Fatty acid degradation
sauz00280  Valine, leucine and isoleucine degradation
sauz00310  Lysine degradation
sauz00330  Arginine and proline metabolism
sauz00340  Histidine metabolism
sauz00380  Tryptophan metabolism
sauz00410  beta-Alanine metabolism
sauz00561  Glycerolipid metabolism
sauz00620  Pyruvate metabolism
sauz00625  Chloroalkane and chloroalkene degradation
sauz01100  Metabolic pathways
sauz01110  Biosynthesis of secondary metabolites
sauz01120  Microbial metabolism in diverse environments
sauz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAZ172_2226
   00053 Ascorbate and aldarate metabolism
    SAZ172_2226
   00620 Pyruvate metabolism
    SAZ172_2226
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAZ172_2226
   00561 Glycerolipid metabolism
    SAZ172_2226
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAZ172_2226
   00310 Lysine degradation
    SAZ172_2226
   00330 Arginine and proline metabolism
    SAZ172_2226
   00340 Histidine metabolism
    SAZ172_2226
   00380 Tryptophan metabolism
    SAZ172_2226
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAZ172_2226
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAZ172_2226
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAZ172_2226
Enzymes [BR:sauz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAZ172_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGY90326
UniProt: A0A0E1AKH2
LinkDB All DBs
Structure
PDB: 

Position
complement(2333762..2335189)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgtatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system