KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_2654Help
Entry
SAZ172_2654       CDS       T02886                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00250  Alanine, aspartate and glutamate metabolism
sauz00330  Arginine and proline metabolism
sauz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAZ172_2654
   00330 Arginine and proline metabolism
    SAZ172_2654
Enzymes [BR:sauz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SAZ172_2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGY90753
UniProt: A0A0E1APW1
LinkDB All DBs
Position
complement(2787048..2788592)
Genome map
AA seq 514 aa AA seqDB search
MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagaatttaaaaatgaacctggttacgatttttcagtccaagaaaatgtggat
atgtttaagaaagcattgaaagacgtggaaaaagaattaggtcaagacataccattagtg
attaatggagagaagattttcaaagatgacaaaattaaatcaatcaatcctgcagacaca
tcacaagtgattgcaaatgcatcaaaggcaacaaaacaagatgttgaagatgcatttaaa
gcagcgaacgaagcttataaatcttggaaaacatggtcagcaaatgatcgtgcagagctt
atgttacgtgtttcggcaattattcgtcgtcgaaaagcggaaattgcagcaattatggtt
tatgaagcaggtaagccatgggatgaagcagttggtgatgcagctgaaggtattgatttt
attgaatactatgcacgttcaatgatggacttggctcaaggcaagccagtacttgatcgt
gaaggtgaacacaataaatatttctataaatcaattggtacaggtgttacaattccaccg
tggaacttcccgtttgcgattatggctggtacaactttagcaccagttgtggcaggtaat
acagtgttattgaaacctgctgaggatacaccttatatcgcttataaattaatggaaatt
ttagaagaagcaggattaccaaaaggcgtagttaactttgttcctggtgatccgaaagaa
attggtgattacttagttgatcataaagatacgcattttgttacatttacaggatcacgt
gcgacaggtactagaatttatgaacgtagtgccgttgttcaagaaggtcaaaacttcttg
aaacgtgttatcgctgaaatgggcggtaaagatgccattgtagttgatgaaaatattgat
acagatatggcagcagaagctattgtaacgtcagcgtttggtttctctggtcaaaaatgt
tcagcatgttcacgtgcaattgtgcataaagacgtttatgacgaagtattagaaaaatca
attaaactaacaaaagaattaacgttgggtaatactgtagacaatacgtatatgggccca
gttattaataaaaaacaatttgataagattaaaaattatattgaaattggtaaagaagaa
ggtaaattagaacaaggtggcggcactgatgattcaaaaggttactttgtagaaccaaca
atcatttcaggacttaaatctaaagatagaatcatgcaagaagaaatttttggtccagtt
gttggctttgtgaaagttaacgattttgatgaagcaattgaggttgcaaatgatacagat
tacggtttaactggtgcagtgattacaaataatcgcgagcattggattaaagcggtaaac
gaatttgatgtaggtaatttataccttaacagaggctgtacttcagcagttgttggatac
catccatttggtggtttcaaaatgtcaggtacggacgctaaaacaggtagcccagactac
ttattacacttcttagaacaaaaggttgtttcagaaatgttctaa

DBGET integrated database retrieval system