KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1234Help
Entry
SAV1234           CDS       T00052                                 

Gene name
smc
Definition
(GenBank) chromosome segregation SMC protein
  KO
K03529  chromosome segregation protein
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:sav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sav03036]
    SAV1234 (smc)
Chromosome and associated proteins [BR:sav03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SAV1234 (smc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_29 AAA_23 FliJ DLP_helical Mod_r SbcCD_C FUSC AAA_13
Motif
Other DBs
NCBI-ProteinID: BAB57396
UniProt: A0A0H3JS18
LinkDB All DBs
Position
1293474..1297040
Genome map
AA seq 1188 aa AA seqDB search
MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIHGAVAEIIDVPSKLTQAI
ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETHLESI
KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQS
QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
EQIDAQEATLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggtttatttaaaatcaatagatgccattggatttaagtcttttgcagatcaaaccaat
gttcaattcgataaaggtgtaactgcaattgttggtccaaatggaagcggtaaaagtaat
attacagatgctattaaatgggtgttgggtgaacaatcggctaaatcattacgtggctca
aaaatggaagatattatcttctcaggtgcagaacatcgcaaagctcaaaattatgctgaa
gtacagttaagattagataatcattctaaaaagctcagtgttgatgaaaacgaagttatt
gtaacaagaagattgtatcgaagtggtgaaagtgagtactacataaataatgaccgtgca
agattaaaagatattgccgatttatttttagattctggattgggaaaagaagcgtatagc
attatctcgcaaggtagagttgatgaaatactaaatgctaaaccaattgatagacgtcaa
attattgaagaatcggctggtgtacttaaatataaaaaacgtaaggctgaatcattaaat
aaacttgaccaaacagaagataatttaacgagagtagaagacattttatatgatttggaa
ggtcgcgtagaacctctaaaagaggaggcagctatagctaaagaatataagacactttca
catcaaatgaaacatagtgacattgtagttacagtgcacgatattgatcaatatacaaat
gacaatagacaattagatcaacgtttaaatgatttacaaggtcaacaagcaaataaagaa
gctgacaagcaacgtttaagccaacaaattcaacaatataaaggtaaacgacatcaactt
gataacgatgttgaatcgcttaattatcaattagtaaaagctacggaagcctttgaaaaa
tatacgggacaattaaatgttttagaagaacgtaagaaaaatcaatctgaaacaaatgca
cgatatgaagaagaacaagaaaatttaatggagcttttagaaaatatatcaaatgagatt
tctgaagctcaagatacttataagtctctgaaaagtaaacaaaaagaactcaatgctgtc
attcgtgaacttgaagaacaactatatgtttcagacgaagcacatgatgaaaaattggaa
gaaattaaaaacgaatactatacattaatgtcagagcaatcagatgttaacaatgatatt
cgttttttaaagcatactatagaagagaatgaggctaaaaaatcaagactagattctcga
ttagttgaagtttttgagcaattgaaagatattcagggtcaaataaaaacgacaaaaaaa
gaatatcaacagaccaacaaagaactttctgctgtagataaagaaattaaaaatatagaa
aaagatctcactgatacaaaaaaagcacaaaatgaatacgaagagaaattgtatcaagca
tatcgatataccgaaaaaatgaaaacacgtattgatagtttggcaacgcaagaggaagaa
tacacttattttttcaatggcgtcaaacatattttgaaagctaaaaataaagaattaaag
ggtattcatggtgcagttgcggaaattattgatgtgccatctaaattaactcaggcaatt
gaaacagcattaggtgcttcattacaacatgtcattgtagattcagaaaaagatggacgc
caggctattcaatttttaaaagaacgtaatttaggtcgtgcgacgtttttaccattaaat
gttatacagagtagagtggtagcgactgatattaaatctattgctaaagaggcaaacgga
tttattagtattgcttcggaagcagtgaaagtagcaccagaatatcaaaatattatcggg
aatttattaggtaatacgattatcgttgatcatttaaagcatgcaaatgaattggcacgt
gcgattaaatatcgaactcgtattgttactttggaaggtgatattgtaaaccctggtggt
tctatgactggtggtggcgctcgtaagtccaaaagtattctgtctcaaaaagacgagttg
acaacaatgagacaccaattagaagattacttgcgtcaaacagaatcatttgaacaacaa
tttaaagagttgaagataaaaagtgatcaattaagtgaactgtattttgaaaaaagtcaa
aagcataatacacttaaagagcaagtgcatcattttgaaatggagctcgatagattaact
acacaagaaacacaaataaaaaatgatcatgaagaattcgaatttgaaaaaaatgatggt
tatacgagtgacaaaagtcgacaaactttgagtgaaaaagaaactcatttagaaagtatt
aaagcatctttaaaacgactagaagatgaaattgaacgctacacaaaactttctaaagaa
ggtaaggaaagcgtaactaaaacacaacaaacgttacatcagaaacaatctgatcttgct
gtggttaaagagcgtattaaaacacaacaacagacaatagatcgattaaataatcaaagt
caacaaactaaacatcaattaaaagatgttaaagaaaaaattgcattctttaattcggat
gaagtgatgggcgaacaagcttttcaaaatattaaagatcaaattaatggtcaacaagaa
acgagaacacgcttatctgatgaattagataaattgaaacaacaacgtattgagttgaat
gaacaaatcgatgcgcaggaagctacactacaagtttgtcaccaagatattttagctatc
gaaaatcactaccaagatattaaagctgaacaatcaaagttagatgtattaattcatcat
gcgatagatcatttaaatgatgaatatcaattgactgttgaacgtgcgaaatctgaatat
acgagtgatgaatcgattgacgcattacgtaaaaaagttaagttaatgaagatgtcgatt
gatgaactaggtcctgtaaacttaaatgcaattgaacaatttgaagagttaaatgaacgt
tatacatttttaagtgaacaacgtacagatcttcgtaaagctaaagaaacattagagcaa
attataagtgaaatggatcaagaggttactgaaagatttaaagaaactttccatgctatt
caaggacattttacagctgtgttcaaacaattgtttggtggaggcgatgcagaattgcaa
ttaactgaagccgattatttaacagctggtattgatattgtggtacaaccaccgggtaaa
aagttgcaacatttatcgttactgagtggtggtgagcgtgcattaactgctattgcttta
ctatttgcaattttaaaagtaagatctgcaccttttgttatattagatgaggttgaagct
gcactagatgaagcaaatgttattagatacgcaaaatatttaaatgagttatcagacgaa
acacaattcattgttattacacaccgtaaaggaacaatggaatttgcagataggttatac
ggtgtaacaatgcaagaatcaggtgttactaaacttgtgagtgtgaatttaaatacaata
gatgatgtgttgaaggaggagcaataa

DBGET integrated database retrieval system