KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1302Help
Entry
SAV1302           CDS       T00052                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00564  Glycerophospholipid metabolism
sav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAV1302 (glpD)
Enzymes [BR:sav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SAV1302 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox NAD_binding_8 Lycopene_cycl FAD_oxidored GIDA Thi4 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAB57464
UniProt: Q99UH2
LinkDB All DBs
Position
1375573..1377294
Genome map
AA seq 573 aa AA seqDB search
MWDKSLVFTFFRRRFGMALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMK
VALVEMQDFAQGTSSRSTKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWML
LPMHKGGTFGKFSTSIGLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYV
EYRTDDARLTIEVMKRAAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAK
KVVNAAGPWVDDVRSGDYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAI
PREGKAYVGTTDTFYDNIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPL
IYEEGKDPSEISRKDEIWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSP
CNTKGLAISGGDVGGSKNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQT
SQYHDSKLPLEIYVELVYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADM
LDYSPAQIEAYTEEVEQAIKEAQHGNNQPAVKE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgggacaagtctctcgtttttacattttttaggaggcgttttggaatggcattgtct
acttttaagagagaacatattaaaaagaatttaagaaatgatgaatatgatttagtaatt
attggtggcggtattacaggtgcaggtattgcactagacgcgagtgaaagaggaatgaaa
gttgcattagttgaaatgcaagactttgcacaaggaacaagctcaagatctacaaaatta
gtccatggtggtttacgttacttaaaacaattccaaattggagtagttgccgaaactggt
aaagaacgtgcgattgtttatgaaaatgggcctcatgttacgactccagagtggatgctt
ttaccaatgcataaaggtggaacatttggtaaattctcaacatcaattggtttaggaatg
tatgatcgtttagcaggtgttaagaagtctgaacgtaaaaaaatgttatctaaaaaagaa
actttagctaaagaaccattagttaaaaaagaaggtctaaaaggcggcggttactatgtt
gaatatcgtactgacgatgcgcgtttaactattgaagttatgaagcgtgctgctgaaaaa
ggcgcagaaattatcaactatactaaatctgaacacttcacttatgataaaaatcaacaa
gtaaatggtgttaaagttatagataaattaactaatgaaaattatacaattaaggctaaa
aaagtggttaatgcagcaggcccatgggttgatgatgttagaagtggtgattatgcacgc
aataataaaaaattacgtttaactaaaggtgtacatgttgttattgatcaatcaaaattc
ccattaggtcaagcagtatactttgatactgaaaaagatggaagaatgatttttgcaatc
ccacgtgaaggaaaagcgtatgtaggtactacagatacattctatgacaatatcaaatct
tcaccattaactacacaagaagacagagactatttaatcgatgcgattaattacatgttc
cctagtgttaatgttacagatgaagatattgaatcaacatgggcaggaattagaccatta
atttacgaagaaggcaaagacccttctgaaatctctcgtaaggatgaaatttgggaaggt
aaatcaggtttattaactattgcaggtggtaaattaacaggctatcgtcacatggctcaa
gacattgttgatttagtatctaaacgcttgaaaaaagactacggtttaacatttagtcca
tgtaatacaaaaggtctggcaatttcaggtggcgatgtaggtggtagcaagaactttgat
gcgtttgtagagcaaaaagtagatgtagctaaaggattcggcattgatgaagatgttgca
agacgtttagcatctaaatatggttcaaatgttgatgaattgttcaacattgcgcaaaca
tctcaataccatgatagcaagttaccattagaaatttatgtagaacttgtttatagtatt
caacaagaaatggtatacaaacctaacgatttcttagttcgtcgttctggtaaaatgtat
ttcaatattaaagatgtattagattataaagatgctgtcatcgatattatggcagatatg
cttgattactctccagctcaaattgaagcatatactgaagaagttgagcaagcaattaaa
gaagcgcaacatggaaataatcaaccagcagttaaagaataa

DBGET integrated database retrieval system