KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1367Help
Entry
SAV1367           CDS       T00052                                 

Definition
(GenBank) putative anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01130  Biosynthesis of antibiotics
sav01230  Biosynthesis of amino acids
sav02024  Quorum sensing
Module
sav_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAV1367
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SAV1367
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAV1367
Enzymes [BR:sav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SAV1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: BAB57529
UniProt: A0A0H3JVD4
LinkDB All DBs
Position
1448894..1450300
Genome map
AA seq 468 aa AA seqDB search
MDIFYKKIKANVTPEVLAQLHSKKIILESTNQQQTKGRYSVVIFDIYGTLTLDNDVLSVS
TLKESYQIIERPYHYLTTKINEDYHNIQDEQLKSLPFISGYVGTCSFDLVRHEFPKLQSI
QLEDHKQHDVRLYMVEQVYVFDHYKDELYIIATNQFSNSTKSDLENRVNKSIEDLTKIQP
FMPTQDFDFKTKEIQSNISEERFIEMIQYFKEKITEGDMFQVVPSRIYKYAHHASQHLNQ
LSFQLYQNLKRQNPSPYMYYLNIDQPYIVGSSPESFVSVKDQIVTTNPIAGTIQRGETTQ
IDNENMKQLLNDPKECSEHRMLVDLGRNDIHRVSKIGTSKITKLMVIEKYEHVMHIVSEI
TGKINQNLSPMTVIANLLPTGTVSGAPKLRAIERIYEQYPHKRGVYSGGVGYINCNHNLD
FALAIRTMMIDEQYINVEAGCGVVYDSIPEKELNETKLKAKSLLEVRP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatatattttataaaaaaataaaagcaaatgtaacgcccgaagttttagcacaactt
cattccaagaagatcattttggaaagtacaaatcaacaacaaactaaaggtcgctattca
gttgttatttttgatatttatggcactttaactttagataatgatgtattatcagtaagc
actttaaaagaatcgtatcaaatcattgaaagaccgtaccattatttaacgactaaaata
aatgaagactaccataatattcaagatgagcaacttaagtcattaccgtttatatctgga
tatgttgggacgtgtagctttgatttagtaagacatgaatttcctaaattgcaatcaata
caattagaagatcacaagcagcacgatgtaaggttatatatggttgaacaagtttatgta
tttgaccattacaaagatgagttatatatcatcgcgacgaatcaattttcaaattcaaca
aaatcagatcttgagaatcgagttaataagtctatcgaagacttaactaaaatccaacca
ttcatgcctacacaagattttgattttaaaactaaagaaattcaatcaaatatttctgaa
gaaagatttatcgaaatgattcagtatttcaaagagaaaataacagaaggggatatgttc
caagttgtgccatcaagaatttacaaatatgcgcatcatgctagtcagcatttaaatcaa
ctttcgtttcaactgtatcaaaatttaaaacgacaaaacccaagtccatatatgtattat
cttaatatcgatcaaccatatattgtcggtagttctcccgaaagtttcgtaagtgtcaaa
gatcaaattgtaacaactaatcctattgcaggtacgattcaacgtggtgagacgacacaa
atagataatgagaatatgaaacaactacttaatgatccaaaagaatgcagcgaacatcgt
atgctagttgatttaggacgtaatgatattcatagagtaagtaaaatcggtacctcaaaa
attactaaattaatggttattgaaaaatatgaacatgttatgcatatcgtaagtgaaatc
acaggtaaaataaatcaaaatttatcaccaatgacagttattgcgaatttattaccaaca
ggtaccgtttcaggtgcaccaaaattacgtgcaattgaaagaatatatgaacaatatcca
cataaacgaggcgtttatagtggtggtgttggatacataaattgtaatcataacttagat
tttgctttagcaattcgaacgatgatgatagatgagcagtatatcaacgtagaagctggt
tgtggcgttgtatatgattctattcctgaaaaagaactgaatgaaacgaaattgaaagct
aaaagcttattggaggtgaggccatga

DBGET integrated database retrieval system