KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1380Help
Entry
SAV1380           CDS       T00052                                 

Definition
(GenBank) oligopeptide transport ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sav00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAV1380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sav02000]
    SAV1380
Transporters [BR:sav02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SAV1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_13 AAA_16 AAA_22 Glyco_hydro_18 AAA_21 RsgA_GTPase AAA_23 AAA oligo_HPY APS_kinase AAA_29
Motif
Other DBs
NCBI-ProteinID: BAB57542
UniProt: Q99UA2
LinkDB All DBs
Position
complement(1461444..1462217)
Genome map
AA seq 257 aa AA seqDB search
MSLIDIQNLTIKNTCEKYLIKGIDLKIFSQQINALIGESGAGKSLIAKALLEYLPFDLSC
TYDSYQFDGENISRLSQYYGHTIGYISQNYAESFNDHTKLGKQLTAIYRKHYKSSKEEAL
SKIDKALSWVNLQSKDILNKYSFQLSGGQLERVYIASVLMLEPKLIIADEPVASLDALNG
NQVMDLLQHIVLEHGQTLFIITHNLSHVLKYCQYIYVLKEGQIIERGNINHFKYEHLHPY
TERLIKYRTQLKRDYYD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcattgatatacaaaatttaacaataaagaatacttgtgagaaatatcttatt
aaagggattgatttgaaaatttttagtcaacagattaatgccttgattggagagagcggc
gctgggaaaagtttgattgctaaagccttacttgaatatttaccatttgatttaagctgc
acgtatgattcgtaccaatttgatggagaaaatattagtagattgagtcaatattatggt
catacaattggttatatttctcaaaattatgcagaaagttttaacgaccatactaaatta
ggtaaacagttaactgcgatttatcgtaagcattataaaagtagtaaagaagaggctttg
tcaaaaattgacaaggctttgtcgtgggttaatttacaaagcaaagatatattaaataaa
tatagtttccaactttctgggggccaacttgaacgcgtttacatagcaagcgttctcatg
ttggagcctaaattaatcattgcagacgaaccagttgcatcattggatgctttgaacggt
aatcaagtgatggatttattacagcatattgtattagaacatggtcaaacattatttatt
atcacacataacttaagtcatgtattgaaatattgtcagtacatttatgttttaaaagaa
ggtcaaatcattgaacgaggtaatattaatcatttcaagtatgagcatttgcatccgtat
actgaacgtctaattaaatatagaacacaattaaagagggattactatgattga

DBGET integrated database retrieval system