KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0166Help
Entry
SAHV_0166         CDS       T00588                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase homologue
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00010  Glycolysis / Gluconeogenesis
saw00053  Ascorbate and aldarate metabolism
saw00071  Fatty acid degradation
saw00280  Valine, leucine and isoleucine degradation
saw00310  Lysine degradation
saw00330  Arginine and proline metabolism
saw00340  Histidine metabolism
saw00380  Tryptophan metabolism
saw00410  beta-Alanine metabolism
saw00561  Glycerolipid metabolism
saw00620  Pyruvate metabolism
saw00625  Chloroalkane and chloroalkene degradation
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
saw01120  Microbial metabolism in diverse environments
saw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAHV_0166 (aldA)
   00053 Ascorbate and aldarate metabolism
    SAHV_0166 (aldA)
   00620 Pyruvate metabolism
    SAHV_0166 (aldA)
  Lipid metabolism
   00071 Fatty acid degradation
    SAHV_0166 (aldA)
   00561 Glycerolipid metabolism
    SAHV_0166 (aldA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAHV_0166 (aldA)
   00310 Lysine degradation
    SAHV_0166 (aldA)
   00330 Arginine and proline metabolism
    SAHV_0166 (aldA)
   00340 Histidine metabolism
    SAHV_0166 (aldA)
   00380 Tryptophan metabolism
    SAHV_0166 (aldA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAHV_0166 (aldA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAHV_0166 (aldA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAHV_0166 (aldA)
Enzymes [BR:saw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAHV_0166 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: BAF77049
LinkDB All DBs
Position
185145..186632
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system