KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2400Help
Entry
SAHV_2400         CDS       T00588                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00010  Glycolysis / Gluconeogenesis
saw00260  Glycine, serine and threonine metabolism
saw00680  Methane metabolism
saw01100  Metabolic pathways
saw01110  Biosynthesis of secondary metabolites
saw01120  Microbial metabolism in diverse environments
saw01130  Biosynthesis of antibiotics
saw01200  Carbon metabolism
saw01230  Biosynthesis of amino acids
Module
saw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saw_M00002  Glycolysis, core module involving three-carbon compounds
saw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAHV_2400
  09102 Energy metabolism
   00680 Methane metabolism
    SAHV_2400
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAHV_2400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saw04131]
    SAHV_2400
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saw04147]
    SAHV_2400
Enzymes [BR:saw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAHV_2400
Membrane trafficking [BR:saw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAHV_2400
Exosome [BR:saw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAHV_2400
  Exosomal proteins of melanoma cells
   SAHV_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAF79283
UniProt: A7X656
LinkDB All DBs
Position
complement(2546229..2546915)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system