KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0708Help
Entry
USA300HOU_0708    CDS       T00629                                 

Definition
(GenBank) ABC superfamily ATP binding cassette transporter, ABC protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
Pathway
sax02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    USA300HOU_0708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sax02000]
    USA300HOU_0708
Transporters [BR:sax02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    USA300HOU_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_18 AAA_23 AAA_22 AAA_14 Tmemb_9 Cytidylate_kin AAA_24 AAA_16 MMR_HSR1 Rad17 AAA FtsK_SpoIIIE AAA_33 AAA_30 AAA_28
Motif
Other DBs
NCBI-ProteinID: ABX28729
LinkDB All DBs
Position
758353..760026
Genome map
AA seq 557 aa AA seqDB search
MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLNHFDKLQLKEQRFLTIYDF
ILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMVLTLFEQAVPMTNVAYYKADTDQ
ALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
AIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEIDDKDKFESLNVLLQSQQLFDGT
IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAITRMLLKDTAST
WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
QLLANQGALWNMIQYNA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgactaaaatttcaagtagataaggatttattgttagctatagttgttggt
gtttgtggaagtttagttgcgctcgccatgtttttcttaagtggttatatggtgacacaa
agtgcacttggtgcgccactatacgctctgatgattttagtcgttacagtaaaattgttt
gggtttttaagagctattactcgatacgtagagcgccttatttctcataaagctacattt
acaatgctacgtgatattcgggtacagtttttcggtaaattagtaaatgtcattcctaat
gtttaccgtaaactgagttctagtgatttaatttcacgtatgattagtcgtgttgaggca
ttacaaaatatatatttacgtgtttattatccaccagtcgtcatcggtttgacagcgcta
gttacagtcatagttttggcgttcatttcaatcggccatgcgctattgattatggttagc
atgttgttcactttactcattgttccttggttaagctcaaaaaaagcacgtactttaaag
aaacatgcagctaatgaacaggcccgatttttaaatcatttttatgattataaagctggt
atggatgaactacgtcgatttaatcaaattaatcattatcgagataatttgatggctaaa
ttaaatcattttgataaattacaacttaaagagcaacgctttttaacgatttatgatttt
atattaaatattattgctatgctttcgatttttggtagtttagttctaggattaattcaa
attaatgcaggccaactaaatattatttatatgacgagtatagttttaatggtcttaact
ttatttgaacaagctgtaccaatgacaaatgtcgcgtattataaagcggatactgaccaa
gcattgcacgatattaatgaagtgatatctgtaccttctactaatggaaaaaaacgtctt
aatgataagtatgatgcaacgaacatttatgaagttaaggatgctagttttaagtattgg
aatcagcaaacgtatgtgttgtcggatattaattttaatgttaatagaggcgaaaagatt
gcgattgtgggtccttctggttcaggaaaaagtacattactacaaattatggcagggtta
tatcaattagatagtggctctgttcgtttcgaaaatatggatatgtttgaaatagatgac
aaagataagtttgaatcgttaaatgtcttgctacaatctcaacaattatttgatggtaca
atacgtcaaaatttatttaccgatgaaaaagatgaagcggtgcaagcaatatttaagcaa
ttagatttagaacatttggcactagaacgtcaaattgacttagatggtcatacattatct
ggcggagaaattcagcgtttagcgattacgaggatgttattaaaagatactgcatcaaca
tggattttagatgaaccaacaactgcattagataaacaaaatagtttaaaagttatggat
ttaattgaagcacatgcagaaacattaattgttgctacacacgatttaactttattgtca
cgttttgagaccatcattgtgatgataaatggtaaaatagttgaaaagggaaactatcaa
caattactagctaatcaaggtgctttatggaatatgattcaatataatgcataa

DBGET integrated database retrieval system