KEGG   Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA): USA300HOU_0900Help
Entry
USA300HOU_0900    CDS       T00629                                 

Definition
(GenBank) hypothetical protein
Organism
sax  Staphylococcus aureus subsp. aureus USA300_TCH1516 (CA-MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1450
Motif
Other DBs
NCBI-ProteinID: ABX28921
UniProt: A8Z1J8
LinkDB All DBs
Position
934823..935059
Genome map
AA seq 78 aa AA seqDB search
MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGDS
PEELLQNIYAHIKETWIF
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgatcgtagaattttgtctctctaacatggcaaaaggtggagattatgttttt
aatcaactggaaaatgacccagatgtcgatgtgttagagtatggttgcctgacacattgt
ggtatatgttcagccgggttgtatgctttagtaaatggtgatattgttgaaggtgattcg
ccggaagaattattacaaaatatatatgcacatataaaagaaacttggattttttaa

DBGET integrated database retrieval system