KEGG   Sulfobacillus acidophilus TPY: TPY_1510Help
Entry
TPY_1510          CDS       T01576                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:say00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TPY_1510 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:say02000]
    TPY_1510 (pstB)
Enzymes [BR:say01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     TPY_1510 (pstB)
Transporters [BR:say02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    TPY_1510 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 AAA_25 AAA_30 AAA_33 IstB_IS21 Rad17 NTPase_1 AAA_5 AAA AAA_24 PRK RsgA_GTPase NACHT Mg_chelatase TsaE AAA_28 NB-ARC AAA_29 SbcCD_C AAA_15 Pox_A32 RNA_helicase MobB AAA_18 AAA_19 SRP54 G-alpha
Motif
Other DBs
NCBI-ProteinID: AEJ39694
LinkDB All DBs
Position
1431248..1431985
Genome map
AA seq 245 aa AA seqDB search
MWYGSQRALAKVSLRIPAGHVLALIGPSGCGKTTFLRTLNRMVDRTPGVRIAGRVTIGSM
DVLAPGLDLPALRRKVGMVFQSPNPFPFTIFDNVAYGPRIAGMTEPHALRLIVEKSLKQA
SLWDEVRGKLRRSALTLSGGQQQRLCIARALAVEPDVLLMDEPTAALDPVSTAKIEELIR
VLRSRYTIVVVTHNLQQAARISDYTAFFAGGELIEVGPTRKMFTAPDDPRTEAYLTGRYE
GYDGR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtatgggtcgcagcgggcgttggcaaaagtctctctaaggattccggcaggccat
gtgctggcgttgattgggccgtccggttgtggaaaaaccacctttttacgtacgttaaac
cgcatggtggatcgtacgcccggggtacgcatcgcgggtcgggtcaccatcgggtcaatg
gacgtgttggcgcccggcttggatttgcccgccctacggcgtaaagtgggcatggtcttt
cagtcccctaatccgttcccgtttacgatttttgacaacgtggcgtatgggccgcgaatc
gcggggatgaccgagccgcacgctttacggctgattgtcgaaaaaagtctgaagcaagcg
tctttatgggacgaagtgcggggcaaattgcggcgctcggccctcacgctctccgggggg
cagcagcaacggctttgtattgcacgggcgctggcggtagagcccgacgtgttgttgatg
gatgaaccgacggcggccttggacccggtttcgacggccaaaatcgaggagttaatccgt
gtactccgatcgcgttacacgatcgtggtggtgactcacaacctccaacaggcggcacga
atttcagactataccgcattttttgccgggggcgaattgattgaggtgggccctacccgt
aaaatgtttaccgcgcccgatgatccccgtaccgaagcatatttgaccgggcgctatgaa
ggatatgatggccgatga

DBGET integrated database retrieval system