KEGG   Sulfobacillus acidophilus TPY: TPY_3352Help
Entry
TPY_3352          CDS       T01576                                 

Gene name
alaS
Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
say  Sulfobacillus acidophilus TPY
Pathway
say00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:say00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TPY_3352 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:say01007]
    TPY_3352 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:say03016]
    TPY_3352 (alaS)
Enzymes [BR:say01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     TPY_3352 (alaS)
Amino acid related enzymes [BR:say01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   TPY_3352 (alaS)
Transfer RNA biogenesis [BR:say03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TPY_3352 (alaS)
 Prokaryotic type
    TPY_3352 (alaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c tRNA_SAD DHHA1 HrcA
Motif
Other DBs
NCBI-ProteinID: AEJ41504
LinkDB All DBs
Position
complement(3094238..3096856)
Genome map
AA seq 872 aa AA seqDB search
MKASDIRQKFLQFFAAQGHQVVPSSPLVPAGDPTLLFTNAGMVQFKDVFLGKEKRSYSRA
VTVQKCMRAGGKHNDLDQVGRTARHQTFFEMLGNFSFGDYFKRDAIDYAWRFLTGELGLD
PAKLWITVFETDDEAYRLWQEVAGVPSDRIVRMGEKDNFWSMGDTGPCGPSSEIFVDRGE
EYACGPQCGLGQCDCDRIQEIWNLVFMQYNRDETGTLTPLPRPSIDTGMGLERIAAYLQG
VDSNFETDLIFPLIRTLEDMTGVSYDPGPEGMPFRVIADHIRAITFLLAEGVSFSNEGRG
YVMRRILRRAMRYGRLLGFESPFLYQLVPVVGEIMGDAYPEVTNGQTVIQELVKNEENRF
LATLSAGMRVLAQKLESLQPGAVLSGEDAFQLYDTFGFPLDLTRDVADEHQVRVDEAQFE
VLMQEQRERARQNRGKTVQHLPAPGPTTFWGYETLELDNEPIQAIFLGDDRVERLETGDQ
GWVYLARTPFYPEGGGQVGDTGWITTATGLAEVLDTLKSGETIWHVVAVRQGFVKSGQPA
QLRVSVEKRLAAMRNHTGTHLLHAALRQILGEGVHQTGSLVAPDRLRFDFSYPRPLTREQ
VTAIEDLVNEWILQDLPVHKAEMGKDEALAQGALAFFGDKYGERVRVVTVPGASQELCGG
THCTRTGEIGLFAILEDSSVGAGSRRIEAVTGLNSLTAFRERRAVSDALLTLFNGTSLAD
IPDRVRQLQEEARQLADALREKERQARHERGRQLAAEAHLVGGYRWLVERVEDTASVEEL
REVLDGVKERVDGAVLVANHHDRVSLMVYFGERVRHLGHRARDVVKELARPIQGGGGGRD
DVAQAGGRNPEGIARVLELAQHWVAENFDRAG
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcttcggatatccgccaaaagtttctacagtttttcgccgcccaaggtcatcag
gtggttcccagttccccgcttgtgccggccggggatccgacattgttatttacaaacgcc
ggaatggtgcaatttaaggacgtttttctcggaaaagagaagcggtcttattcgcgcgcc
gtcacggtccaaaagtgcatgcgggccggcggaaaacacaacgatttggatcaagtgggt
cgcaccgctcggcatcaaacgtttttcgaaatgctgggcaacttttcgttcggggattat
tttaagcgggatgcgattgattacgcatggcgtttcttgaccggtgaattgggtttggat
cccgccaaactctggattacggtgttcgaaacggatgacgaagcctatcggctgtggcaa
gaggtggccggggtgccttccgaccggattgtccgcatgggagaaaaagacaacttttgg
agcatgggcgatacggggccgtgtggtccctcgagcgaaatttttgtggatcgtggggaa
gaatacgcctgcggtccccagtgcggtttaggtcaatgtgattgtgaccggattcaagag
atctggaatctggtttttatgcaatacaaccgtgacgaaaccgggactttgactccgtta
ccgcgtcccagtatcgacaccggcatgggtttggagcggattgccgcttatttacaaggg
gtggattccaactttgaaaccgacttgatttttcccttgattcgtacgctggaggatatg
acgggagtatcttacgacccgggaccggagggcatgccgtttcgggttatcgccgatcat
attcgagcgattacgtttttgttagccgaaggggtgtccttcagcaatgagggtcgggga
tatgtgatgcgccggattctccggcgcgcgatgcgctacggtcggttactgggatttgag
tcgccgtttttatatcagttggtacccgtagtcggcgagatcatgggagacgcatatccg
gaagtgaccaatgggcagacggtgatccaagaattggtcaaaaacgaggaaaatcgtttt
ctggccacgttaagcgcggggatgagggtgctggcgcaaaaactggaatcgctccagccc
ggcgctgtgttgtccggggaagacgcgtttcaactgtatgacacgttcggctttccgctg
gatttaacccgggatgtggccgacgaacatcaggtgcgggtggatgaagcccaatttgag
gttttgatgcaagaacagcgcgaacgggcgcggcaaaaccgcggaaaaaccgtgcagcac
ctgccggcgccgggccctacgacattttggggctatgagacgctcgagctggataacgaa
ccgattcaagccatttttttgggagacgaccgggtcgaacggttggaaaccggcgatcaa
gggtgggtgtatctcgctcggacaccgttttaccccgaagggggcggccaagtcggggat
acgggctggattaccacggccaccggtctggcggaagtgttggatacgttaaagtccggc
gagaccatctggcatgtggtcgccgttcgccaaggatttgtcaagtcgggtcaaccggcg
caattgcgggtttctgtcgagaaacggttagctgctatgcgtaatcacaccggcacccac
ttgcttcatgccgcactgcggcagattttaggcgagggggttcatcaaaccgggtcgtta
gtggcccccgatcggctccgtttcgatttctcctatcctcggcctttaacgcgggagcaa
gtgacggctattgaagatcttgtgaatgaatggattctgcaggatttgcccgtgcataaa
gcggaaatggggaaagacgaggccttggcgcagggggcgttggccttttttggcgacaag
tatggggagcgggttcgcgtggtcacggttccgggagccagtcaagaattatgcggcggt
acccattgtacccggaccggcgaaatcggcctatttgccattttggaagacagcagcgtg
ggcgccggctcccggcggattgaagcggtgaccgggcttaacagcctgacggcgtttcgg
gaacggcgggcggtgtcggatgcgctattaactctctttaacgggacgagcttagccgat
attcccgatcgggtccggcaattgcaggaggaggcccgtcaattggcggatgccctgcgg
gaaaaggaacggcaggcacgccacgaacgcggtcgtcaactcgcggccgaagcccacctc
gtcgggggctaccggtggttggttgagcgtgtggaggataccgcgtcggtggaggaattg
cgtgaggtgttggatggcgtcaaggagcgcgtcgatggggcggttttagtggcaaatcat
cacgatcgcgtctcattgatggtatactttggagagcgtgttcggcatttgggacaccgg
gcacgcgatgtggtgaaagaattggctcgccccatccaaggcggcgggggcggccgcgat
gacgtggcccaagccggcgggcgcaacccggaggggattgcccgggtattggaactggcc
cagcattgggtggcggaaaattttgatcgggcaggataa

DBGET integrated database retrieval system