KEGG   Shewanella amazonensis: Sama_0032Help
Entry
Sama_0032         CDS       T00445                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
saz  Shewanella amazonensis
Pathway
saz00071  Fatty acid degradation
saz00280  Valine, leucine and isoleucine degradation
saz00281  Geraniol degradation
saz00310  Lysine degradation
saz00362  Benzoate degradation
saz00380  Tryptophan metabolism
saz00410  beta-Alanine metabolism
saz00640  Propanoate metabolism
saz00650  Butanoate metabolism
saz00903  Limonene and pinene degradation
saz00930  Caprolactam degradation
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
saz01212  Fatty acid metabolism
Module
saz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sama_0032
   00650 Butanoate metabolism
    Sama_0032
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sama_0032
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sama_0032
   00310 Lysine degradation
    Sama_0032
   00380 Tryptophan metabolism
    Sama_0032
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sama_0032
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sama_0032
   00281 Geraniol degradation
    Sama_0032
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sama_0032
   00930 Caprolactam degradation
    Sama_0032
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sama_0032
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sama_0032
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sama_0032
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sama_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABL98244
UniProt: A1S1I8
LinkDB All DBs
Position
complement(34377..36527)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELTADKIARLCFNAPGSVNKFDRETLASLNAALDVLKDSDAKAAVLTSGK
DTFIVGADITEFLALFAEEDAKLMEWIAQANVVFNKLEDLPFPTVSAIKGFALGGGCEAI
LATDFRVADTSAKIGLPETKLGLIPGFGGTVRLPRLIGADNALEWITTGKDQRPEDALKV
GAIDAVVAPENLEAAAIQMLNDALAGKLDWQARRARKQAPLTLPKLEAMMSFTTAKGMVY
AVAGKHYPAPMAAVSVVEQAAGMSRAEALVVEHNAFIKLAKTDVATALIGIFLNDQLVKG
KAKKASKLAKDIKHAAVLGAGIMGGGIAYQSASKGTPIVMKDINQAALDLGVNEAAKLLS
AQVARGRSTPDKMAKVLNNITPALDYAPLKDVNVVVEAVVENPKVKAMVLADVENVVADD
AIIASNTSTISIDLLAKSLKNPARFCGMHFFNPVHKMPLVEVIRGKDTSEETVASVVAYA
SKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLADGGDFAAIDKVMEKQFGWPMGPAYLL
DVVGLDTGHHAQAVMADGFPDRMGKSDKDAIDVMYEAGRLGQKNGKGFYQYSIDKRGKPK
KDVDPASYTMLAEAFGAQKAFEADEIIARTMIPMIIETVRCLEEGIVASPAEADMGLVYG
LGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRELASNNGSYYPKA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaatccaggtcgaattgaccgctgacaagattgcccggctc
tgtttcaacgctcccggctcggtcaacaagttcgatcgtgaaaccctcgcctctctcaat
gccgcactcgatgttctcaaagactcagatgccaaggccgctgttctgacctctggtaaa
gacacctttatcgttggcgccgacatcaccgagtttttggccctcttcgccgaagaagac
gccaagctgatggagtggattgcccaggccaacgtagtatttaacaaactcgaagacttg
cctttcccaacggtatccgccatcaaaggattcgcactgggcggcggctgtgaagcaatt
ctggccaccgatttccgtgttgccgataccagcgccaagataggcctgccagaaaccaag
ctcggcctcatccccggttttggtggcaccgtgcgcctgccgcgcctgattggtgccgat
aacgcactggagtggatcaccacaggtaaagatcagcgccccgaagatgcccttaaagtg
ggggcaattgatgcggtagtcgcccccgaaaatctggaagcagcagcaattcagatgctc
aacgatgccctcgccggcaagctcgactggcaagcccgccgcgcccgcaaacaggcaccg
ctgacgctgccaaaactcgaagccatgatgtctttcaccaccgccaaaggcatggtgtat
gccgttgccggcaagcactaccctgcgcccatggcggctgtgtcagtggttgagcaagct
gccggtatgagccgcgccgaagctctggtggttgagcacaatgcctttatcaagctggct
aaaaccgatgtagccactgcgcttatcggtattttcctcaacgaccagttggtaaaaggc
aaggcgaaaaaggcctccaaactggccaaggatatcaagcacgccgccgtattgggcgcc
ggtatcatgggtggtggtattgcctaccaaagcgccagcaagggcacacctatcgtcatg
aaagacatcaatcaggccgcactggatttgggtgtgaacgaagccgccaagctgctcagc
gcccaggttgcccgaggccgctcaacgccagacaaaatggcgaaggtactcaataacatc
accccggctctggactatgcgccactaaaagacgtgaacgttgttgtagaagctgtggtg
gaaaatcccaaggttaaagccatggtgcttgccgatgtggaaaatgtggtggccgacgat
gccattatcgcttccaacacttccaccatctccatcgacttactggcgaagagccttaaa
aaccctgcccgtttctgcggtatgcacttctttaacccggtacacaagatgccgctggtt
gaggtaatccgtggtaaagataccagcgaagaaaccgttgcctcagtggtggcttatgcc
agcaagatgggcaaaacccccatagtggtaaacgactgcccgggcttcttcgttaaccgt
gtactcttcccttactttgctggcttcaatggtctgttggccgatggcggcgacttcgca
gccatcgacaaggtaatggaaaagcagtttggctggccaatgggtcctgcctacctgctg
gacgttgttggtctggacaccggccaccacgcccaggccgtaatggcggatggtttccct
gaccgcatgggcaagtcagataaagatgccattgatgtgatgtacgaagccggtcgcctc
ggtcagaagaacggtaagggcttctaccagtacagtatcgataaacgtggcaagccgaag
aaagacgtagacccagcctcttacaccatgcttgccgaagcctttggtgctcagaaagcc
ttcgaggccgatgaaattattgcccgcaccatgatccccatgatcattgaaacggtacgc
tgccttgaagaaggcattgttgccagcccggccgaagccgatatggggctggtgtatggc
cttggcttcccgccattccgcggtggcgtattccgctatctggataccatgggcgtggcc
aactttgtggctctggccgacaaatacgcccatctgggcggcctgtatcaggtgaccgac
gccatgcgcgaacttgccagtaacaatggcagctactatccaaaggcctga

DBGET integrated database retrieval system