KEGG   Shewanella amazonensis: Sama_0618Help
Entry
Sama_0618         CDS       T00445                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sama_0618
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sama_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Thi4 AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase NAD_binding_7 Glutaredoxin Spermine_synth DNA_pol3_delta
Motif
Other DBs
NCBI-ProteinID: ABL98826
UniProt: A1S370
LinkDB All DBs
Position
771262..772824
Genome map
AA seq 520 aa AA seqDB search
MLNADLKQQLKTYLQNLRQDVRLVVSADDSKKSQELLDLANDISSLSPLVSVTQARLERT
PEMQVTNAQGTDIRFAGLPMGHEFTSLVLALLHTGGHPLKLDMAVIEQIKALPQTLKFET
FISLSCQNCPDVVQALNMMAALNPNVSSTMIDGALFQDEVESRQIMAVPSVFLNGELFSQ
GRISLKEILAKVDTQAAAREADALSEKAPYEVLVVGAGPAGASAAIYSARKGLRTGLVAD
RFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDVMENQKALKLTKDGLYQVEL
ANGAVLSGKTVLIATGARWREMNVPGEKEYRGRGVAYCPHCDGPLFKGKRVAVIGGGNSG
IEAAIDLANIVEHVTVLEFDSKLRADEVLVRKARSMGNIHIITQAQTTEVVGDGNKVTGL
VYTDRATGDVHSVELAGIFVQIGLVPNSEWLKGTLELTPRGEIIVDERGQTSLPGVFAAG
DVTNSAYKQIIIAMGSGATASLGAFDYLIRHSEADASAAA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacgcggatttgaaacagcaacttaagacctatctgcaaaatctacggcaagac
gtcagactcgtggtgtctgccgatgacagcaaaaaatctcaggaattgctcgacctggcc
aatgacatctcctccttgtctccgttggtttcagtgacccaggccaggctcgagcgcacc
cctgaaatgcaggtaaccaatgctcaggggaccgacattcgttttgccggtttgcccatg
ggccacgaatttacgtcgttggtgttggcactgctgcacacaggcggtcatcccctcaag
ctggatatggctgttattgaacaaatcaaggcgctgccacagaccctgaagtttgaaacc
tttatctccctgagctgccaaaactgtcccgatgtggtgcaggctctgaacatgatggcc
gcgctgaatccgaacgtcagcagcaccatgattgatggggccctgtttcaggacgaggtg
gaatctcggcagatcatggccgtaccctcggtgttccttaatggtgaactcttttcccag
ggtcgcatcagcctgaaggagattctcgccaaggtggatacccaggctgcagcccgagaa
gccgatgccctgagtgagaaagccccttacgaagtattggtagtgggcgcaggccccgcc
ggtgcctctgccgccatttattcggcccgtaaaggcttgcgtaccggtctggttgccgac
cgatttggcggtcaggtggctgaaaccgtgggcattgagaactttatttcagtgaaagcc
actgaaggccccaagctggtggcaaaccttgaagcccacgttcgcgattacgaagtggat
gtgatggaaaaccagaaggctctcaagctgaccaaagacggtctgtatcaggtggagttg
gccaatggtgctgtgttatcgggtaaaactgtactgattgccaccggtgcacgctggcgt
gaaatgaatgtgcccggtgaaaaagaataccgtggccgcggcgtggcttactgtcctcac
tgtgatggccccttgttcaaaggtaaacgcgttgccgtgataggtggcggtaattcgggt
atcgaagctgccatcgacctggccaacatagttgagcatgtcactgtgctggagtttgac
agcaagctgcgcgccgatgaggtgctggttcgcaaggctcgctctatggggaatatccac
atcatcacccaggcacaaaccaccgaggtggtgggtgacggcaacaaggtgaccggcttg
gtctacaccgaccgagctacaggtgatgtacacagtgttgagctggcgggtatcttcgta
cagattggtcttgtacccaactcagagtggcttaagggcacactggaactgaccccgcgc
ggcgagatcatagtggatgagcgtggccaaacctcgctgccgggtgtatttgccgcggga
gacgtgaccaactctgcctacaagcaaatcattattgccatgggcagtggtgctaccgcg
agcctgggggcgtttgattacctcatccgtcacagcgaggcagatgcttcagctgccgcc
tga

DBGET integrated database retrieval system