KEGG   Shewanella amazonensis: Sama_1150Help
Entry
Sama_1150         CDS       T00445                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
saz  Shewanella amazonensis
Pathway
saz00061  Fatty acid biosynthesis
saz00780  Biotin metabolism
saz01100  Metabolic pathways
saz01212  Fatty acid metabolism
Module
saz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Sama_1150
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Sama_1150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:saz01004]
    Sama_1150
Enzymes [BR:saz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Sama_1150
Lipid biosynthesis proteins [BR:saz01004]
 Fatty acid synthase
  Component type
   Sama_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas DUF1830
Motif
Other DBs
NCBI-ProteinID: ABL99357
UniProt: A1S4Q1
LinkDB All DBs
Position
1400901..1401362
Genome map
AA seq 153 aa AA seqDB search
MSNQMNTMDIKEILKYLPHRYPFLLIDRVLDFTAGESLHAIKNVTINEPFFVGHFPVAPV
MPGVLILEAMAQATGLLAFKTMSSEPSPDVLYYFAGIDNARFKRVVEPGDQLHFEVKMIK
ERRGIGVFYGEAKVDGELVCSAEIMCARREISK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaatcaaatgaacaccatggatatcaaagagatacttaagtatctgccccacaga
tatccgtttctgctcatagaccgtgtgctggacttcaccgctggtgaatctttgcacgcc
atcaaaaacgtcaccatcaacgagccattttttgtggggcatttccctgtcgctcccgtg
atgcctggcgtattgatccttgaagctatggcccaggcaactggccttctggcattcaag
accatgagcagcgagccatcgccagatgtgctttattattttgccggtatcgacaatgct
cgttttaaacgtgttgttgagccgggcgaccagctgcactttgaagtgaaaatgattaag
gaacgccgcgggattggtgtgttctatggtgaggccaaagtggatggtgagctggtttgc
agcgcagaaatcatgtgtgcccgcagagagattagcaagtga

DBGET integrated database retrieval system