KEGG   Shewanella amazonensis: Sama_1200Help
Entry
Sama_1200         CDS       T00445                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
saz  Shewanella amazonensis
Pathway
saz00250  Alanine, aspartate and glutamate metabolism
saz00410  beta-Alanine metabolism
saz00430  Taurine and hypotaurine metabolism
saz00650  Butanoate metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz02024  Quorum sensing
Module
saz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sama_1200
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sama_1200
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sama_1200
   00430 Taurine and hypotaurine metabolism
    Sama_1200
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sama_1200
Enzymes [BR:saz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sama_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS IKKbetaNEMObind
Motif
Other DBs
NCBI-ProteinID: ABL99407
UniProt: A1S4V1
LinkDB All DBs
Position
complement(1471185..1472867)
Genome map
AA seq 560 aa AA seqDB search
MPPAVHKTARRDEMTEKHLRKATASEDNLLRIFTVPEAADSTLGRIEQQLSADLAGFLQD
NIAALEQPLSDIEDHFYSVEVPPQPQFVSDYVDDIMAHLVAQSVHTAAPSFIGHMTSALP
YFLLPLSKLMVGLNQNLVKIETSKAFTPMERQVLGMMHHLIYGREKDFYQGFLHSASHAL
GAFCSGGTVANITALWIARNQLLKARGNFRGVTREGLHKALKHYGWDDLAILVSERGHYS
LGKAADLLGIGRDNIISVPVDAHNKVDIDAMRVAAAQLQARNIRVMAIVGVAGTTETGNV
DPLAEMAALAKEIDCHFHVDAAWGGATLLSEKYRYLLSGIELADSVTIDAHKQMYVPMGA
GMVLFKNPSFASAIEHHAEYILRQGSKDLGSQTLEGSRPGMAMLVHACLNIIGREGYEIL
INGSLERARFFAGLIEAQTDFELISEPELCLLTYRYVPAKVRLALAQAVAQHDKDKLDAI
GSLLDDLTRAIQKTQREQGKSFVSRTRITPKRYGNDKRTVFRVVLANPLTTEAILAAVLE
EQRALASGETEILQALDALC
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggcggtgcacaagacagccagacgtgatgagatgacagaaaaacacctgcgc
aaggccacagcctctgaagacaacctgttgcggatctttaccgtaccggaggcggctgac
tctaccctcggccgtatcgagcagcagctgtctgccgatcttgccggtttcctgcaggac
aatattgccgcgctggaacaacctctgtcagatattgaggatcacttctacagtgtcgaa
gtgccaccacaaccccagtttgtctccgattacgtggatgacatcatggctcatttggtg
gcgcagtcggtacacactgctgcgccatcgtttatcggccacatgacctctgccctgccc
tatttcctgttgcccctgtcgaaactgatggtggggctgaatcagaatctggtgaaaatc
gaaacctccaaggcctttacccccatggagcgtcaggtgctgggcatgatgcaccacctg
atttatggccgcgaaaaggatttctatcagggcttcctccacagcgccagccatgcactg
ggggctttttgctccggcggaaccgttgccaacatcacagcgctgtggattgcccgcaac
cagttactgaaagcccgtggtaacttcaggggcgtgacccgtgaaggcctgcataaggcg
ctcaaacattatggctgggatgatttggcgattctggtgtctgaacgtggtcactactcc
ctcggcaaagccgcagatctgcttggcatcggccgggacaacatcatcagcgtaccggtg
gatgcccataataaggtggatattgacgccatgcgggttgctgcagcccaattacaggcg
cgcaatatccgggtaatggccattgtcggcgtcgcgggcaccacagaaaccggcaatgtg
gatcctcttgctgagatggcagcccttgccaaagagatagactgccatttccatgtggat
gcggcctggggcggcgctaccctgctgtctgaaaagtatcgttatctgctcagcggtatc
gaactggcggattcggtcaccatagatgcccacaagcaaatgtatgtgcccatgggcgca
ggtatggtgctgtttaaaaatccaagctttgcctctgccatcgagcatcatgccgagtac
atcctgcgtcagggctccaaggatctgggcagccagactctggaaggttcacgccccggg
atggcgatgctggttcatgcctgtttgaacatcattggccgcgaaggctacgaaatcctg
ataaacggctcgctggagcgcgcccgattttttgcggggctcattgaggcccaaacggat
tttgagcttatcagcgaaccggagctgtgcctgctgacctacagatacgtgcctgcaaag
gtgcgcctggcactggcacaggcagtagcgcagcacgacaaagataaactcgatgccatt
ggcagtctgcttgacgatctcacccgcgccattcagaaaacccagcgcgagcagggtaaa
tcctttgtctcccgcacccgtatcacgcccaagcgctatggtaacgacaagcgcaccgtg
ttcagggttgtgctggccaatcccctcacaaccgaggccatactggccgcggtgctggaa
gagcaacgagcgctggcaagcggggaaactgagatactgcaggccctcgacgctctgtgt
tga

DBGET integrated database retrieval system