KEGG   Shewanella amazonensis: Sama_1656Help
Entry
Sama_1656         CDS       T00445                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
saz  Shewanella amazonensis
Pathway
saz00500  Starch and sucrose metabolism
saz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sama_1656
Enzymes [BR:saz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sama_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ABL99862
UniProt: A1S656
LinkDB All DBs
Position
complement(2021005..2023458)
Genome map
AA seq 817 aa AA seqDB search
MPVTHSSSLRALSLAIAAALGVSACQKAPAPQETTPDKAMVKIAPGAPGNTPLWAFAGKT
GIGTSYEPYVDGAYVSTVENPVSRVWYSVANGVLTETMYGLIHNAQLRELSFIIKGEDFI
DFEAKDANHHQDYLHLDDKGLPESLALLLTSTDKEQKYRIEKKIVTDPHRDSLIMRVSIE
ALEDGITPFLYADPHIDNGGADDLAYLSDTGFVVTDKADASSALSLEISIDFVRRQVGFE
GVSSGVEAIKAGHPLPGYSQTFADAAAPQVGNVALTGELKTLARGETLTFDVVLGFGQGA
DAATANARASLTAGFDSLAQDFRGNDTTPGWRQYLASLPALSAMGNATADNGRLLNLSAM
VLKAQEDKTHAGALIASLSNPWGDTIPAVTPSTGYKAVWPRDFYQCAMAFLALGDTQTPK
VAFEYLKQIQAGPGLKGYEGAPGWFLQKTHVDGQIEWVAVQLDQTAMPIMLGWKLWQAGE
LSDDEARHWYQEMLKSAADFLVSGGHIKLDWNERTITPPSTQQERWEEQAGFSPSTIAAV
ITGLQAAAALAEHAGDSEGAQKYLAAATRYSEQLEARTVTNKGLLSDKPYILRISPEGTP
DTDAKLADNNGRPGLDQRQILDGGFLELVRYGVRTADNPLVLNTLALVDDTTLEDNLRIR
YDFTTAQGQAFPGFRRYGNDGYGEDTVTGANYAENGSNSANQRGRVWPFFTGERGHYELA
KATVGGQPLSEADKRRLINTYVAGMESLANGGGMLPEQVWDGVGDATRFGYRLGDGTNSA
TPLAWTHAEYVKLVRSVHDAKVWDNYPFAKQPAPETK
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
gtgccagtgacccattcttcttcgcttcgtgccctcagccttgccatagcagccgcgctt
ggtgtgtctgcctgccaaaaggcccctgcaccccaggaaaccactccggataaggcgatg
gtgaaaattgccccgggcgcgcccggcaacacgcccttgtgggccttcgcaggcaaaacc
ggaataggtaccagttacgaaccctatgtggacggtgcttatgtgagtaccgtcgagaat
ccggtgagccgggtgtggtattcggtggccaacggcgtgctgaccgaaaccatgtatggt
ctgattcacaatgctcagcttcgtgagctgtcctttatcattaagggcgaggattttatt
gattttgaagccaaagatgccaaccatcaccaggactatctgcacctggatgataaaggg
cttccggagtccctggcactgctgctcaccagtaccgataaagagcaaaaataccgcatc
gagaaaaagatagtcacagatccccatcgggattctcttatcatgagggtcagcattgaa
gccctcgaagatggcattacccccttcctgtatgccgatccgcacatcgataatggtggc
gccgatgacctggcgtatctgtctgacaccggttttgttgttaccgataaggcagacgct
tccagcgccttgagtctggagatcagtatcgatttcgtgcgccgtcaggtgggctttgaa
ggggtatccagtggcgtcgaggccattaaggccgggcatcccctacccggctacagccaa
acctttgccgatgccgcggctccccaggtggggaacgtggccctcaccggcgagcttaaa
acactggccaggggtgaaaccctcacgtttgatgtagtactgggctttggtcagggtgcg
gatgcagcaacggccaacgccagggcgtcccttaccgccggctttgattcgctggcacag
gacttcagaggcaacgacacaacccccggctggcgccagtatttggcgtccttgccagcc
ctcagcgccatgggtaatgccacggcagacaatggccgcctccttaacctgagtgccatg
gtgctcaaggcacaggaagacaaaacccatgcaggcgcgctgattgcctccctctccaac
ccttggggcgataccatacctgcggtcacgccaagcactggttacaaggccgtttggcca
agggatttttatcagtgcgccatggcgtttttagccctgggtgatacccaaacccccaag
gtcgcatttgagtacctcaaacagatccaggcaggcccgggtctcaaaggctacgaaggt
gcgcccggttggttcctgcaaaagacccatgtggatgggcaaatagaatgggttgcggtg
cagctggaccaaactgccatgccgattatgcttggctggaagctgtggcaagccggtgag
ctcagtgatgatgaggcacgtcactggtatcaggagatgctcaagagcgcggccgacttt
ttggtcagcggcggtcacattaaactcgactggaatgagcgtaccatcaccccacccagt
acccaacaggaacgctgggaagaacaggccgggttttcaccttctaccatagcggctgtg
attaccggtttgcaggcagcagcagcccttgccgagcatgcaggcgacagcgaaggggcg
cagaaatacctcgctgctgccacgcgctacagtgagcagctcgaagctcgtaccgtaaca
aacaaagggctgctgtcggacaaaccctatattctgcggatttcccccgagggcacaccg
gataccgacgccaagctcgccgacaataatggtcgtccggggctggatcagcgtcagatc
ctcgatggtggcttcctggagttggtgcgttatggcgtgcgcaccgctgacaatccactc
gtcctcaatacccttgctctggtggacgacacgaccctggaagacaatctgcgcatccgt
tatgacttcaccacggcccagggacaggcatttcccggcttcaggcgttacggtaacgac
ggctacggcgaagatactgtcacaggcgccaactatgccgagaacggcagcaacagtgcc
aatcagcgtggacgggtatggcccttctttaccggcgagcgcggtcattatgagcttgcc
aaagccacagtgggtggccaaccactcagtgaggccgataagcgccgcctgattaatacc
tacgtggcaggaatggaaagccttgccaacggcggcggtatgctgcctgaacaggtgtgg
gacggtgtgggcgacgccacccgctttggctatcgtttgggtgatggtaccaactcggcg
accccccttgcctggacccacgccgaatacgtaaaactggtgcgctccgtccatgatgcc
aaggtctgggataactaccccttcgccaagcagccagcccctgaaacaaagtag

DBGET integrated database retrieval system