KEGG   Shewanella amazonensis: Sama_1920Help
Entry
Sama_1920         CDS       T00445                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sama_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABM00126
UniProt: A1S6W9
LinkDB All DBs
Position
2346731..2347315
Genome map
AA seq 194 aa AA seqDB search
MAFELPPLPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIPGTEFEGKSLEEIVKTS
TGGVFNNAAQVWNHTFYWNCLAPNGGGAATGPVADAINAAFGSFEEFKAKFTDAAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDDSVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
ELVNWDFVNQNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccccactgccatacgcaaagaacgcactggaaccccatatttcc
caggaaactatcgagtaccactacggcaagcaccacaacacctacgtggttaagctgaac
ggcctgatcccaggtaccgagttcgaaggcaagagcctggaagaaatcgtaaagacctcc
accggtggtgtgttcaacaacgcagctcaggtatggaaccacaccttctactggaactgt
ctggcccctaacggcggtggcgctgccactggtccggttgccgatgccatcaatgcagct
ttcggttctttcgaagaattcaaagccaagttcaccgacgccgcagtgaacaacttcggt
agtgcctggacttggttggttaagaaagctgacggcacagttgctattgtaaacaccagc
aacgccgccactccgctgaccgatgattctgttactccgatcctgactgtggatgtgtgg
gaacacgcttattacatcgattatcgcaacgtacgtcctgattacctggcccacttctgg
gaactggtaaactgggacttcgtaaaccagaacttcgctggttaa

DBGET integrated database retrieval system