KEGG   Shewanella amazonensis: Sama_2490
Entry
Sama_2490         CDS       T00445                                 

Definition
(GenBank) A/G-specific DNA-adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
saz  Shewanella amazonensis
Pathway
saz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:saz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Sama_2490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saz03400]
    Sama_2490
Enzymes [BR:saz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     Sama_2490
DNA repair and recombination proteins [BR:saz03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Sama_2490
 Prokaryotic type
     Sama_2490
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: ABM00694
UniProt: A1S8I7
LinkDB
Position
2992315..2993421
AA seq 368 aa
MSEQTARIPFGKRIVLWYDKHGRKSLPWQQNKTPYKVWVSEIMLQQTQVATVIPYFERFM
ASFPTVNDLANAHEDEVLHHWTGLGYYARARNLHKAAQLIRDEHGGEFPTEFDAVLALPG
IGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIEGWPGEKRVDTALWQLTEALTPKED
IQKYNQAMMDMGANICTRSRPKCGECPVAIDCKAQLAGRQGEFPGKKPKKTIPAREGWML
ILQQANTVKLIKRPPSGIWGGLWCFPQFDSKQALHAFVEANGLDAENLTLLDGFRHTFSH
FHLDIQPVKLRLGSTQTEALIMEDNLSLWYNLLQGENLGLAAATERILASLVSELKQESG
GSAAAHKE
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtccgagcaaacagcccgcattccttttggaaagcgtatcgtcctgtggtacgacaaa
cacggccgcaagagcctgccatggcagcaaaacaagacgccttataaggtatgggtgtcg
gaaatcatgctgcagcaaacccaggtggctaccgttatcccctacttcgagcgctttatg
gcaagcttccccacggtgaacgaccttgccaacgcccatgaagatgaagtgctgcaccac
tggaccggccttggctactatgcccgtgcccgcaacctgcacaaggccgcacagctcatc
cgcgacgagcacggcggcgagttcccaaccgagttcgatgccgtgctggcactgcccggc
attggccgctccacggcaggtgccgtgttgtcattatctttagggcagcatcatcctatt
ctcgatggcaatgtaaaaagagtgctggcgcgacacggcgccatcgaaggctggcccggc
gagaaacgggtcgataccgccctgtggcaactcaccgaagcgctaacccccaaagaagac
atacaaaagtacaatcaggccatgatggatatgggtgccaatatctgcacccgcagccgc
cccaagtgtggtgagtgccccgttgccatcgactgcaaggcgcagcttgccggccgtcag
ggtgagttccccggtaaaaagcccaaaaagaccattcccgcccgggaaggctggatgctg
attctgcagcaagcaaacaccgtcaagcttatcaagcggccacccagtggcatctggggc
ggcctctggtgcttcccccaatttgatagcaagcaagcgctccatgcctttgtcgaagcc
aatggcttagatgcagaaaatctcaccctgctggatggctttcgtcacacattcagccac
ttccatctggatattcagccggtcaaactgcgccttggcagcacacagacagaggcgctt
atcatggaagataacctgagtctctggtataacctcctccaaggcgaaaatcttgggctt
gccgccgccaccgagcgaattctggcaagccttgtaagcgaacttaagcaagaatccggc
ggcagcgctgccgcccacaaggagtaa

DBGET integrated database retrieval system