KEGG   Sulfurospirillum barnesii: Sulba_0724Help
Entry
Sulba_0724        CDS       T02139                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00550  Peptidoglycan biosynthesis
sba01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sulba_0724
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sulba_0724
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sba01011]
    Sulba_0724
Enzymes [BR:sba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sulba_0724
Peptidoglycan biosynthesis and degradation proteins [BR:sba01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Sulba_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AFL68029
UniProt: I3XVQ5
LinkDB All DBs
Position
692024..693844
Genome map
AA seq 606 aa AA seqDB search
MRIKIVLSIVFFVCIALLIRVYYISIKSNAYYEEIAKQNAIKVDELAPLRGVILDRNLNP
LSINRLGFAIGITPRMSVKSKRELLENEIAFLSSLMPEYSVESLTKTYLKADSSYNHDYV
NVIDFVPYDKMIPHFAKIAQREYTSIKITSKRHYPHGALASHIIGYVGKSNTQDVAEDEI
AKLVGFSGKTGIEKYYNAVLQGVKGEKKTKVTALNQEIEEVSKTLPQSNDLVLSLDLELQ
RYLETVFDEPSGAVIVMNAKNGEILAAASFPEYDLNTFVGGISQEEWSRLANDLKHPFTN
KLVNGLYPPGSVIKMGVGMAILNTGIITPQTIIESTGVMELGGRLFRDWKKDGHGMVSYI
KAIQRSCDDYFYKTSLKVGIDNIAPFLKKVGFGQKTGVDLPREFVGIVPSREWKKERFGK
GWSQGETLISSIGQGYFLVTPMQIAKYTAFLATGNGVTPHFLHKVNDVKIDFPADPNIVT
PEEKRFLKVTRDGMYEVANVPGGTALNHLKHNAPFKIAAKTGTAQVVGISQTDKKRMREE
DMEYYHRSHAWLTTYAPHDNPQYVVTVLVEHGGHGGSEGGPIAAKIYDKLYEMGYITIPE
AKEGKK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcaaaattgtcttaagcattgttttttttgtgtgtatcgccttgttgattagg
gtttattacattagcattaaatcaaatgcctattatgaagagatagccaagcaaaatgct
attaaggtggacgaattggcgccacttcgtggtgttattttggatcggaatttaaatcca
ctttctattaatcgtctgggttttgccattggtattacgcctcgcatgagcgtaaaatca
aagcgtgaattgcttgagaatgaaattgcttttctctcctctttaatgcctgaatacagt
gtagagagtctaacaaagacctatttaaaagcggattcatcgtacaaccatgattatgtg
aatgttattgattttgtaccgtatgacaagatgattcctcattttgccaaaattgcgcaa
agagagtataccagtattaaaattacctccaaacggcactatccgcatggtgcgttagcc
tcacatatcattggttatgttggtaaatcaaatacgcaagatgtcgccgaagatgagatt
gcaaagttggttggattttcaggaaaaacaggtattgagaagtattacaatgctgtttta
caaggggttaaaggagaaaaaaagacaaaggttactgctctgaatcaagagattgaagag
gtgagtaaaaccttaccccaaagtaatgatttagtcttaagcttagatcttgaactacaa
cgctatcttgagacggtttttgatgaacccagcggggcagtcattgtcatgaatgcaaag
aacggtgaaattttagcagcagctagttttcctgagtatgacctcaatacctttgtggga
ggcatttctcaagaggagtggtcacgccttgctaatgatttaaaacatccctttacaaat
aagctggtcaacggtttgtaccctcctggttctgtcattaaaatgggtgttggtatggca
attttaaatactggtattattacgccgcagacaatcattgaaagtacaggtgttatggag
cttggtggtcggttatttcgtgattggaaaaaagatgggcatggtatggtgagttacatt
aaagccattcagcgaagctgtgatgattatttttataaaaccagtttgaaagtgggcatt
gataatattgcgccttttttaaaaaaagtgggttttgggcaaaaaacgggggtggattta
ccacgtgagtttgtcggtattgtgcccagtcgtgaatggaaaaaagagcgttttggcaaa
gggtggtcacaaggtgaaaccttaatcagctcaatagggcaggggtattttttggttacc
cctatgcaaattgctaaatacaccgcttttttagccacaggaaatggagtgacaccgcat
tttttacacaaagtcaatgatgttaaaattgactttcctgctgatcccaacattgtgaca
ccagaggaaaaacgttttttaaaagttacacgtgatggtatgtatgaagttgcaaatgtt
cctggtggaacggcactcaatcaccttaaacataacgcaccatttaagattgccgctaaa
acgggaaccgcacaggtggttggaatttctcaaacggataaaaaacgaatgcgtgaagaa
gatatggagtactatcatcgctcgcacgcatggcttacgacctatgccccgcatgataac
cctcaatatgttgttacggtcttagtcgaacacggagggcatggaggaagcgaaggtgga
ccaattgctgctaaaatctatgataagttgtatgagatgggctacattacaattcctgaa
gctaaagagggtaaaaaataa

DBGET integrated database retrieval system