KEGG   Sulfurospirillum barnesii: Sulba_0737Help
Entry
Sulba_0737        CDS       T02139                                 

Definition
(GenBank) ubiquinone-dependent succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00020  Citrate cycle (TCA cycle)
sba00190  Oxidative phosphorylation
sba00650  Butanoate metabolism
sba01100  Metabolic pathways
sba01110  Biosynthesis of secondary metabolites
sba01120  Microbial metabolism in diverse environments
sba01130  Biosynthesis of antibiotics
sba01200  Carbon metabolism
Module
sba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulba_0737
   00650 Butanoate metabolism
    Sulba_0737
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Sulba_0737
Enzymes [BR:sba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Sulba_0737
    1.3.5.4  fumarate reductase (quinol)
     Sulba_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 HI0933_like Thi4 FAD_oxidored GIDA Pyr_redox_3 Lycopene_cycl AlaDh_PNT_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFL68042
UniProt: I3XVR8
LinkDB All DBs
Position
705816..707663
Genome map
AA seq 615 aa AA seqDB search
MSEQFTRREFLQSACITMGALAASTTGVEKAFAASSPSTNTSGIPTCDVLIIGSGAAGLR
AAVAARKKNPKLSVVVVSKVMPTRSATSMAEGGINGVIDFSEGDSFELHAKDTVKGGDYL
VDQDSALKFATYASEAIHELDYIGMPFSRNAKGQVDRRYAGGASKIRCNFAKDKTGQILT
HTCLDDALKNGVKFLMEHQMLELSIENGNCEGVVLRNIRTGDIAPVRAKSVVLATGGYTR
VFWNRTSTPYIATGDGAAAVLRAGLAFKDPEMLQFHPTGVCHGGALITEAARGEGGILLN
NQGERLMKRYVPNKMELAPRDIVSRSIETEIREGRGFGHDMEAYVLLDVTHLGEEKIMRN
LPQIRHVGLLFENIDLVKQPIPIRPTAHYSMGGIHVTSIDTMATTAPGLFAAGEASCVSI
HGANRLGGNSLCDTNVTGKIAGINAAEYASKADFGSGKRLKDLTLKWISHFKEITGSGKG
NVNDMYALREEMGAANWYNMGIFRTESKLLALADKHAEFQARYEALRIPNANPIFNTAYT
EYIELGNLLLASRAALMGATARKESRGSHYREDYLKRDDANFLKHTMVTMDESGKMHLAW
KDVVVGQFKIEERKY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcagtttaccagaagggaatttctgcagtcagcctgtattaccatgggtgct
ttggctgcaagtacaacgggcgttgaaaaagcatttgcggcttcttcaccttcaaccaat
acatcaggtattccaacctgtgatgtattaattattggctcaggggctgcgggtcttcga
gctgcggttgccgcacgaaagaaaaatccaaagctaagtgttgtggtcgtgagcaaggtg
atgcctacacgaagtgcaaccagtatggcagagggtggtattaacggggtcattgatttt
agtgagggtgattcatttgaattgcacgctaaagatacggttaaaggaggagattatcta
gttgatcaagatagcgctcttaaatttgcaacgtatgccagtgaagcaattcatgaactg
gattatataggtatgccattttctcgaaatgcaaaaggtcaagtggatagacgttatgca
ggcggtgcttctaaaattcgctgtaatttcgccaaagataaaacaggacagattttaaca
cacacctgtttggacgatgcacttaaaaacggggttaagtttttgatggaacatcagatg
ctcgagttaagtatcgagaatggaaattgtgagggtgtggtgcttcgcaatattagaaca
ggtgatattgctcctgtgcgtgccaaatcggtcgttttagccacaggcgggtatacccgt
gtgttttggaatcgtacctcaacaccgtatatcgcaacaggcgatggtgcagcagcagtc
ttgcgtgcaggtttagcgtttaaagaccctgagatgcttcaattccacccaacaggtgtt
tgccatggtggagcacttattaccgaagccgcacgtggcgagggtggcatcttgctcaac
aatcaaggtgagcgtttgatgaaacgttatgtgcctaacaaaatggaactagctcctcgt
gacattgtctcccgctccattgaaacagagattcgtgaaggacgtggttttgggcatgac
atggaagcgtatgttcttcttgatgtaacgcatcttggcgaagaaaaaatcatgagaaac
ttaccacaaattcgccatgtcgggctcttgtttgaaaatatagaccttgtgaaacagcct
attcctatccgtccaacggcacactactctatgggtggtattcacgttaccagcattgat
acgatggcaacaacagcgcctggtctttttgccgcaggtgaagcctcatgtgtttctatt
catggtgcaaatcgtttgggtggtaactcactgtgcgataccaatgtcacaggaaaaatt
gcaggtattaatgccgcagagtacgcaagtaaagcagattttgggtctggaaaacgcctc
aaagatttaacattaaaatggattagccattttaaagagattacaggttcaggcaaaggc
aatgtgaacgacatgtatgcgcttcgtgaagagatgggcgctgccaactggtataacatg
ggtatctttagaaccgagtctaaattgcttgcacttgcggataaacatgctgaatttcaa
gcacgttatgaagcgcttcgtatccccaatgccaacccaattttcaacacagcctataca
gagtatatcgagcttggtaacttgttgcttgcctctcgtgctgcactgatgggtgcgaca
gcgcgcaaggaatcacgtgggtctcattaccgtgaggattacttaaaacgtgatgatgcc
aatttcttaaaacacacgatggtcacaatggatgagagcggtaaaatgcacttagcttgg
aaagatgttgtggtgggtcagtttaaaattgaagagaggaaatactaa

DBGET integrated database retrieval system