KEGG   Sulfurospirillum barnesii: Sulba_0738Help
Entry
Sulba_0738        CDS       T02139                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00020  Citrate cycle (TCA cycle)
sba00190  Oxidative phosphorylation
sba00650  Butanoate metabolism
sba01100  Metabolic pathways
sba01110  Biosynthesis of secondary metabolites
sba01120  Microbial metabolism in diverse environments
sba01130  Biosynthesis of antibiotics
sba01200  Carbon metabolism
Module
sba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulba_0738
   00650 Butanoate metabolism
    Sulba_0738
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Sulba_0738
Enzymes [BR:sba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Sulba_0738
    1.3.5.4  fumarate reductase (quinol)
     Sulba_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_9 Fer4_8 Fer4_17 Fer2 Fer4_7 Fer4_10 Fer4_18 Fer4_16 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AFL68043
UniProt: I3XVR9
LinkDB All DBs
Position
707663..708622
Genome map
AA seq 319 aa AA seqDB search
MKFIIDRFDGKRNYQQTYTVEKKDIEALTLLGVLLLIKQTQDITLNFTASCRMAICGACS
VRVNGHSYLACDTKMTELFEEYKDMETFRISPLANFTVISDLAVDWEPAIENLRKVKPGL
VAKSEFSEKEGCRQNQEEYDRIEKQWDCILCGSCASECNKLSADRSDYMEPFVYTRAWKV
ANDSRSKDPMIHVKPAVANGLWNCVHCQECISRCPKHISSADDIAGLTVLAIKKGLTSGL
GPAHAKAFHTDLVEGSGRLNEIYLALRTEGVSTVARTGMAITLMRAGKMNPLEIFGGHTI
EGHKDLVKMIKAAKAATKE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatcattgatcgctttgatggcaaaagaaattatcaacaaacctataccgta
gagaaaaaagatattgaggccttaacacttttaggtgtcttgcttttaattaaacaaacg
caagacattacccttaattttacagcatcgtgtcgtatggcgatttgtggggcgtgttct
gtgcgtgtcaatggacactcttatcttgcgtgtgataccaaaatgacagagttgtttgaa
gagtataaagatatggagacttttagaatctctcctttggcaaattttacggtcatttca
gatttagcggtggattgggagccagccattgagaatcttcgtaaagttaaaccaggtttg
gtcgcaaaatcggaattttcagaaaaagagggatgtcgtcaaaatcaagaagagtatgac
cgcatcgagaagcagtgggattgtatcttgtgtggaagctgtgcttctgagtgtaacaaa
ctctctgcggatagaagtgactacatggagcctttcgtctacactagagcatggaaagtt
gccaatgattcacgctctaaagatccgatgattcatgtaaagcctgcggttgccaatggt
ttatggaattgtgtgcattgtcaagagtgtattagccgttgccccaaacacatcagctca
gccgatgatattgcaggtttaaccgttcttgccatcaaaaaaggactcaccagtggttta
ggaccagcacacgctaaagcgtttcataccgacctcgttgaaggctctggtcgcttaaat
gaaatctatttggcactcagaaccgagggtgtgagcacggttgcaagaacagggatggct
attacgttgatgcgtgctggaaaaatgaacccgctggaaatctttggtggacataccatc
gaaggacataaagatttagtaaaaatgattaaagcagccaaagctgcaacaaaggagtaa

DBGET integrated database retrieval system