KEGG   Sulfurospirillum barnesii: Sulba_1290Help
Entry
Sulba_1290        CDS       T02139                                 

Definition
(GenBank) hypothetical protein
Organism
sba  Sulfurospirillum barnesii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spc7
Motif
Other DBs
NCBI-ProteinID: AFL68582
UniProt: I3XXA8
LinkDB All DBs
Position
1254487..1256532
Genome map
AA seq 681 aa AA seqDB search
MEKHKLLGSQFFALLFLMLLVIGGIASYTLGNFGGVSFDELGEKYIPKDDVKFSDLPLET
QKRYIDKEATLAQSKEANALELENYVDEFGKAIPENAVNMQDLKRMITRLQKTLLFLHHD
YFLMTNEKDELVQKIEMQQKEYEKEKQAWLQQSTQRLNEAEEHHFKNISELTLKLNDLQK
ENLLLSHKIESESNDLKSEIESQKAKQAQDDAKKHQEIHLAREEERAKFLSYETSIAELN
TNLDALKEKLHLQEAEYQTRFENEKKELEIKNQLLESSTKQLQELEAKHTETLRLKEEAI
VKENATHEEEVKHLKSELSSAKKHVDALLLESEKDLAKFKHYLDEEKKRYSELSFENQHY
KEAMQAKIETLTLTVEKAKEEAAQKEQKLQELTQTITKLQAITQDIDKEVEKRVDEISQT
HNKNYRIFNEKMAHFERYKQELLQQLDGQLNEYKATAKENFERIEHQNKELTQKNEALSL
EKENYAKELQTVQQQLILLREKHEAMQQADMQKLKETHESLLRLQEQLKAKDESIKTLHV
NHKEALKSKENAPRSNEPLNYIAQINCEDMGTGVDALSEKCKTDIKSFLSRYDRSYFFEI
TPIVDNSGFASLALLKTKKVGIEESEIERISALANIGLGKARAKAGGELVTSYVGEGAKI
SYALSNIEQAKARGFQIKVYR
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacataagctcttaggttcgcaattcttcgcacttttatttttgatgcttctt
gtgattggcggtatagcctcgtacaccttaggaaattttggaggtgtctcttttgatgaa
ctaggagagaagtacattcctaaagacgatgttaagtttagtgacctgcctttagaaact
caaaagcgctacattgataaagaagcaactctagcacaaagcaaagaggcaaatgcctta
gaattagaaaactatgtcgatgaatttggtaaagctattcctgaaaatgctgtgaacatg
caagatttaaagcgtatgattacccgtttgcaaaaaacccttcttttcttgcatcatgac
tattttttaatgaccaatgaaaaagatgaacttgttcaaaaaatagagatgcaacaaaaa
gagtacgaaaaagaaaaacaagcatggctacagcagagcacacaacgccttaatgaagca
gaagagcatcattttaaaaatatcagcgaattgaccctaaaattaaatgatcttcaaaaa
gaaaaccttttactctcccataaaatagagagtgaatccaatgacttaaaatcagaaatt
gaatcgcaaaaagcaaaacaagcacaagatgatgccaaaaaacatcaagaaattcaccta
gcacgagaagaagaacgggctaaatttcttagctatgagacaagtattgcagaacttaac
acaaatcttgacgcattaaaagaaaagcttcaccttcaagaagcagaatatcaaacacgt
tttgaaaatgaaaaaaaagaactggaaataaaaaatcaactccttgaatcttccacaaaa
cagcttcaagagttggaagcgaaacatacagaaaccttacgattaaaagaagaagctatt
gttaaagaaaatgccacgcatgaagaagaagtgaaacacctaaaatcagagctttcaagt
gcaaaaaaacatgttgatgctttacttttagagagtgaaaaagatttggcaaaatttaaa
cactatcttgatgaggaaaagaagcgttatagcgaactaagctttgaaaatcaacactat
aaagaagcgatgcaagccaaaattgaaaccttaaccctcacagtggaaaaagccaaagaa
gaggctgctcaaaaagaacaaaagcttcaagaattaacccaaaccatcacaaagcttcaa
gccattacgcaggatattgataaagaagttgaaaaacgtgtcgatgaaatcagccaaact
cacaacaaaaactaccgtatttttaatgaaaaaatggctcattttgagagatacaaacaa
gaactactccaacaactcgatggtcaattaaacgaatataaagcaactgctaaagaaaat
tttgaacgtatagagcaccaaaacaaagaactcacccagaaaaatgaagccttgagtttg
gaaaaagaaaactacgcaaaagaacttcaaaccgttcaacaacagctgatactcttgcgt
gaaaaacatgaggcgatgcagcaagccgatatgcaaaaactcaaagaaacacatgagtca
ctcctaagactgcaagaacaactcaaagcaaaggatgaaagtataaaaaccttacatgta
aatcataaagaagcactcaaatcaaaagagaatgctcctcgctcaaatgagccattgaac
tatatagctcaaataaactgtgaagatatgggaacaggagtggatgccctttctgaaaaa
tgcaaaacagatataaaaagctttttatcacgctatgatcgttcttatttctttgaaata
acacccattgtggacaattcaggctttgcttctttagcgcttcttaaaacaaagaaagtt
ggcattgaagagagtgagattgagcgtattagtgctcttgctaacattggacttggcaaa
gccagagccaaagcaggtggtgagttggttacatcttacgtaggagagggggcaaaaata
agctatgccctctcaaacattgaacaagctaaagcacggggttttcagatcaaggtgtat
cgctaa

DBGET integrated database retrieval system