KEGG   Sulfurospirillum barnesii: Sulba_2013Help
Entry
Sulba_2013        CDS       T02139                                 

Definition
(GenBank) putative phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00630  Glyoxylate and dicarboxylate metabolism
sba01100  Metabolic pathways
sba01110  Biosynthesis of secondary metabolites
sba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sulba_2013
Enzymes [BR:sba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Sulba_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD NIF
Motif
Other DBs
NCBI-ProteinID: AFL69292
UniProt: I3XZB8
LinkDB All DBs
Position
complement(1997001..1997639)
Genome map
AA seq 212 aa AA seqDB search
MKTILFDLDGTLIDSTDAILESFGVAYDTFGHVAPEDDTIKKLIGHPLDVMFMMLGVSAF
EANDYVAAYKEHYRLISRQKTTLLPLAREAIERASRIATLGVVTTKTARYSEELLEHMGV
MHHFKVLIGRESITHPKPHPEPIQKALQVLDKEAMHTWMIGDTPMDLISAKEAGVEGIGV
LCGYSTHAELLVHTKNILPDAFSAVKWIEEHR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattttatttgatttggacggaacactgattgattcgaccgatgctattttg
gagagttttggtgttgcgtatgataccttcgggcacgtagcaccagaggatgataccatt
aaaaaactcattggacatcctttggatgtgatgtttatgatgctgggggtctccgctttt
gaagcaaatgattatgtggctgcgtataaggagcattatcgtttgatttcacgtcaaaaa
acgacgttacttcctttggcacgtgaggcgattgagagggcatctcgcatcgcaacccta
ggcgttgtgacgacaaaaacagcacgttattctgaagaacttttggagcatatgggtgtg
atgcatcattttaaagtgctgattggacgggagtctattacacatccaaagcctcatcct
gagccaattcaaaaggctttgcaggtgttggataaagaggcaatgcatacgtggatgatt
ggtgataccccgatggatttgatttcagcaaaagaagctggtgttgagggtattggtgtt
ttgtgtggatatagcacacatgctgaacttttagtacatacgaaaaacattcttccagat
gcgtttagtgccgtaaaatggatagaagagcatcgttaa

DBGET integrated database retrieval system