KEGG   Auricoccus indicus: BVH56_00255Help
Entry
BVH56_00255       CDS       T04690                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sbac  Auricoccus indicus
Pathway
sbac00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BVH56_00255
Enzymes [BR:sbac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BVH56_00255
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BVH56_00255
    1.1.1.-  
     BVH56_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_assoc HI0933_like
Motif
Other DBs
NCBI-ProteinID: AQL55485
UniProt: A0A1Q1FZG4
LinkDB All DBs
Position
complement(44490..45542)
Genome map
AA seq 350 aa AA seqDB search
MKAAVFHNVKDVRVEDVELKELSPTGVKIKVAWAGICGTDLHEYLAGPIFVPLNEENPLT
HDKAPVTLGHEFSGIVEEVGQDVTSVKSGDKVVVNPLIISGEHENGLYDMYNDSTFYGLG
TDGGFAEFAIIEEKHVIKLEDDTSLKLGALVEPTAVALQAIRESRMEFSDSVAVYGAGPI
GLLTIIAARAAGAKDIFVFDLSEERLKKAKEVGATHIVNSGEQNPIEYIKQYYPDGVDRT
FEVAGVPITVKQSILSTRPRGVVTVVSIFEKAMDFNPMILTTSGVHLASTLAYEDDIFEA
TIKMIESGQIDPSPVITDRIELDEIVDKGFKALTNDKSQAKILVKLSGEE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtattccataatgtaaaagatgtacgcgttgaagatgttgagctgaaa
gaattgtccccaactggtgttaaaattaaagtcgcatgggcaggtatttgtggtacagac
ttacatgagtatttagcaggtcctatttttgttcctttaaatgaagaaaatcctctcaca
catgacaaagctcctgtcacattaggccatgaatttagcggtatcgttgaagaagttgga
caagacgtaacttctgttaaatccggagataaagtcgttgttaacccattaatcattagt
ggtgaacatgaaaatggattgtatgatatgtataatgactctactttctatggtcttgga
acagatggagggtttgctgaatttgcaataatagaagagaagcacgtgattaaattagaa
gacgatacatccctgaaattaggtgctctcgttgaaccaacagcggttgcattacaagcc
attcgagaatctcgtatggagttcagtgattcagttgcagtatacggcgccggtcccatt
ggattattaacaattattgctgcacgtgcagctggtgcaaaagatatttttgtttttgac
ttaagtgaagaacgtctaaagaaggcaaaagaagttggtgcaacgcatatcgtcaatagc
ggtgaacaaaaccctatcgagtacattaaacagtactatccagacggtgttgaccgaaca
ttcgaagtagccggtgtaccgattacagttaaacaatccattctatcaacacgccctcgc
ggtgtcgtgacggtcgtttcaatcttcgaaaaagctatggatttcaacccaatgatttta
acaacatcaggtgtacatttagcatcaacacttgcatacgaagatgatattttcgaagca
acaattaagatgattgaatctggtcaaattgatccttcacctgtcattacagatcggatt
gaacttgatgaaattgtcgacaaaggatttaaagcattaacaaatgataaatcacaagcg
aaaattttagtcaaattatctggtgaggaataa

DBGET integrated database retrieval system