KEGG   Auricoccus indicus: BVH56_00400Help
Entry
BVH56_00400       CDS       T04690                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sbac  Auricoccus indicus
Pathway
sbac00010  Glycolysis / Gluconeogenesis
sbac00280  Valine, leucine and isoleucine degradation
sbac00310  Lysine degradation
sbac00330  Arginine and proline metabolism
sbac00340  Histidine metabolism
sbac00380  Tryptophan metabolism
sbac00410  beta-Alanine metabolism
sbac00561  Glycerolipid metabolism
sbac00620  Pyruvate metabolism
sbac00625  Chloroalkane and chloroalkene degradation
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVH56_00400
   00053 Ascorbate and aldarate metabolism
    BVH56_00400
   00620 Pyruvate metabolism
    BVH56_00400
  Lipid metabolism
   00071 Fatty acid degradation
    BVH56_00400
   00561 Glycerolipid metabolism
    BVH56_00400
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BVH56_00400
   00310 Lysine degradation
    BVH56_00400
   00330 Arginine and proline metabolism
    BVH56_00400
   00340 Histidine metabolism
    BVH56_00400
   00380 Tryptophan metabolism
    BVH56_00400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BVH56_00400
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BVH56_00400
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BVH56_00400
Enzymes [BR:sbac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BVH56_00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh N2227
Motif
Other DBs
NCBI-ProteinID: AQL55511
UniProt: A0A1Q1FZJ4
LinkDB All DBs
Position
71250..72737
Genome map
AA seq 495 aa AA seqDB search
MVNVRDYIDESYKLLINGEFVDAESGETLKTYSPSTGEELATFAKAGQADVDKAVSAAQE
AFKTWSKTSLQERQALLHKIADKIEENADRIAYAESMDNGKVLRESTGIDIPLGTDHFRY
FAGVPRTELGTVTEMDENTMSLVTREPIGVVGAVVAWNFPFLLASWKLAPALAAGCTIVI
QPSSSTPLSMLELAKIMQEVLPKGVVNILTGKGSESGDMIFNHEGVDKLSFTGSTEVGYS
VADAGAKRLVPATLELGGKSANIIFDDANFEQALEGAQIGILFNQGQVCSAGSRVLVQEG
IYDKFVDALVKKFENIKIGNPLEEGSILGSITSEGQLKKIMGYMDTAKEEGCKILTGGER
VTGGEFDKGFYFKPTIIEVPNNSVTVAQEEIFGPVITVQKFSTKEEAIDIANDSIYGLAG
GVFSTNINTALDVARNVRTGRMWVNTYNQVPSGAPFGGYKKSGIGRETYKDAIANFQQTK
NIYINTLDATMGLYE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgttagagattatatcgacgaaagttataaattattaataaatggtgaattt
gtagacgctgaaagtggcgaaacattaaagacatactcaccgtcaacaggtgaagaatta
gcgacattcgctaaagcgggtcaagcggatgtagataaagcggtaagtgctgctcaagaa
gcattcaaaacatggagcaagacttcattgcaagagcgtcaagcattacttcataaaatt
gctgataaaatcgaagaaaatgccgatcgtattgcatatgcagagtctatggacaatggt
aaagtattacgtgaatcaacagggattgatattccattaggtacagatcacttccgttac
tttgcaggtgttcctcgtaccgaacttggaacggtgactgaaatggatgagaatacaatg
agtttggttactcgtgaaccaatcggagttgttggtgcggttgttgcatggaacttccca
ttcttacttgcttcatggaagttagcaccagcacttgctgcgggatgtacgatcgtcatc
caaccatcatcttcaacaccgttaagtatgttagaacttgctaaaattatgcaagaagta
ttaccgaaaggtgttgtgaacattttaacaggtaaaggatctgaatctggtgatatgatc
ttcaaccacgaaggtgttgataaattatcatttaccggttcaactgaagttggatactca
gttgctgatgcaggtgcgaagcgcttagttccagcaacgttagagcttggtggtaagagc
gcgaacattatctttgacgatgcgaactttgagcaagcattagaaggcgctcaaattggt
atcctattcaaccaaggtcaagtatgttctgcaggaagccgtgtacttgtgcaagaagga
atttacgacaaattcgtagatgcacttgtgaagaagtttgaaaatattaagattggtaac
ccattagaagaaggtagtatccttggttcaattacaagtgaaggtcaattgaagaaaatt
atgggctacatggacactgctaaagaagaaggatgcaagattttaacaggtggagaacgt
gtgacaggtggagaatttgataaaggattctacttcaaaccgacaattatcgaagtacca
aacaatagtgtgacagtagcacaagaagaaatcttcggacctgttattacagttcagaag
tttagcacgaaagaagaagcgattgacattgcgaatgattctatttacggcttagctggt
ggtgtattctcaacaaatattaatactgcattagacgttgcacgtaatgttcgtactggt
agaatgtgggttaacacatataaccaagtaccatcaggtgcaccgtttggtggatacaaa
aaatcaggaatcggtcgtgaaacatataaagatgcaattgcgaacttccaacaaacgaaa
aacatttacattaacacattagacgctactatggggttatacgaataa

DBGET integrated database retrieval system