KEGG   Auricoccus indicus: BVH56_01550Help
Entry
BVH56_01550       CDS       T04690                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sbac  Auricoccus indicus
Pathway
sbac00061  Fatty acid biosynthesis
sbac00620  Pyruvate metabolism
sbac00640  Propanoate metabolism
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
sbac01200  Carbon metabolism
sbac01212  Fatty acid metabolism
Module
sbac_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVH56_01550
   00640 Propanoate metabolism
    BVH56_01550
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BVH56_01550
Enzymes [BR:sbac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BVH56_01550
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BVH56_01550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AQL55725
UniProt: A0A1Q1G055
LinkDB All DBs
Position
267566..268915
Genome map
AA seq 449 aa AA seqDB search
MKKILIANRGEIAIRVIRTCKKMGIKTVSVYSNTDQDALHVAMADEAYCIGPSNAKDSYL
NMDNIITAAEMTGADAIHPGYGFLAENSNFARRCAENNIIFIGPTPETIDAMGDKAEARK
TMVKAGVPVIPGSKDVIPTIEEARQKAHDIGAPLVIKAVAGGGGKGMRIVRDLENFDNLF
HSAKNEALNAFGDDRVYIEKFIRTARHIEVQVIGDGHGNAVHLYDRDCSVQRNNQKLIEE
APAVIVPEDVKDRMTLDAVNAAKNINYAGAGTLEFLYVEETGEYYFLEMNTRIQVEHTVT
EMVTGIDIVEQQIKVALFDTFDLTQDDIQVTGFALECRINAEDPDHGFRPSPGKVEQLFL
PSGPGVRIDTFLYQNYMISPFYDSMIAKVITFDNTREGAINRMKLALNEMVIGQFKTNLL
YQYRILQHPRYMNNLIDIKFLEKNYFLEG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatactaatcgctaatcggggagaaattgcgatacgtgtcataagaacgtgt
aaaaagatgggaatcaagacagtcagtgtctattccaacacagatcaagatgcgcttcat
gttgcaatggctgatgaagcgtattgtatcggtccgtcaaatgcaaaagatagctactta
aatatggataacatcatcacagccgctgaaatgactggtgcggatgcaattcatccaggt
tacggcttcctagctgaaaattctaactttgctagacgttgtgccgaaaataacattata
tttatcggtccgacgccggaaacgattgatgcgatgggggataaagcagaagcacgtaaa
acgatggtgaaggcaggcgttccggttatacctggttcaaaagatgtcattccaacgatt
gaagaagcccgtcaaaaagcacatgacatcggtgcaccacttgtcattaaagcggtagcc
ggtggtggtggcaaagggatgagaattgtaagagatctggaaaactttgataatttattt
cactctgccaaaaatgaggcattaaatgcatttggtgatgatagagtgtacatagagaaa
ttcattcgaacggcacgtcatattgaagttcaagtgattggagatgggcacggtaatgct
gttcatctatatgaccgtgactgttcggttcaacggaataaccagaagttaatcgaagaa
gcacctgcagtgattgtgccagaagatgttaaagatcgaatgacgcttgatgcagttaat
gcagcaaagaacattaactatgctggtgctggaacacttgagttcttatatgttgaagaa
acaggtgaatattacttcttggagatgaatacgcgaattcaagtagagcataccgtgaca
gaaatggttacaggcattgatattgttgaacaacaaatcaaagttgcattatttgatacg
ttcgatttaacacaagatgatatccaagtgactggattcgcacttgagtgtcgaattaac
gctgaagaccctgaccacggttttagaccttcaccaggaaaagttgaacaactcttctta
ccgagtggacctggcgttagaatcgatacattcttatatcaaaattatatgatatcaccg
ttctatgattctatgattgcgaaagtcattacatttgataacacgagagaaggcgcaatt
aatcgaatgaagcttgcactaaacgagatggtcattggtcaattcaagacaaatctttta
tatcaataccgtattttacaacatccaaggtatatgaataacttaatcgatattaaattt
cttgagaaaaactatttcctagaggggtga

DBGET integrated database retrieval system