KEGG   Auricoccus indicus: BVH56_02050Help
Entry
BVH56_02050       CDS       T04690                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sbac  Auricoccus indicus
Pathway
sbac00970  Aminoacyl-tRNA biosynthesis
sbac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BVH56_02050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbac03029]
    BVH56_02050
Enzymes [BR:sbac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BVH56_02050
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BVH56_02050
Mitochondrial biogenesis [BR:sbac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BVH56_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AQL55809
UniProt: A0A1Q1G0L5
LinkDB All DBs
Position
373923..375350
Genome map
AA seq 475 aa AA seqDB search
MNFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNTNTNPIDLGYPGVLPVVNKRAIDFGM
RAAMALNMDISTHSKFDRKNYFYPDNPKAYQISQFDQPLGEHGSIEIEVDGQKKTIGITR
LHLEEDAGKSTHKSGYSLVDINRQGTPLIEIVSEPDIRTPDEAYAYLEKLKSIIQYTGVS
DCKMEQGSLRCDANISIRPYGQDEFGTKTELKNLNSFSFVKKGLEFEEKRQRQVLLGGGE
ILQETRRFDESTGQTVLMRVKEGADDYRYFPEPDLVPLYIDDEWKNAVRETIPVLPDERK
DKYINELGLPAYDAKVLTLTKEMSDFFDEMVALGANAKSASNYLMGNVNEYLNKEQMELV
NSNIKPSNLVELLQLVDDQAISSKQAKKVFQETAKSGDSPKKIVKDLGMEQISDVGTLTQ
FVTEALDENPQSIEDFKNGKDKAIGFLVGQIMKKSKGQANPPLVNKILMEEINKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacagtaatcggattagaggttcacgttgaattaaagacagattcgaaa
atgttctctccttcacctgcacattttggagctgaaccaaatacgaacacaaatccaatc
gacttagggtatccaggtgttttacccgttgtgaataaaagagcgatagattttgggatg
agagcagcgatggcgttaaatatggatatctcaacgcactctaaatttgatcgtaaaaat
tatttttacccagataacccgaaagcatatcaaatctctcaattcgaccagccactcggt
gaacatggatcaattgaaattgaagtcgatggtcagaagaaaacaatcgggattacaagg
ctacatttagaagaggatgccgggaaatcaacacataagtcagggtattcacttgtcgat
attaaccgtcaaggaacacctttgatcgaaatcgtatctgaaccagatataagaacacct
gatgaagcttatgcttatctagagaaattgaagtccatcattcaatataccggagtgtca
gattgtaagatggagcaaggttccttaagatgtgatgcgaatatttcgattagaccgtat
ggtcaagacgaatttggtacgaagacagagctcaaaaacttgaactcattctcttttgtt
aaaaaagggttagaatttgaagagaagagacaacgtcaagtattacttggaggcggggaa
atcctccaagaaacgagacgattcgatgaatctacgggtcaaacggtattaatgcgtgta
aaagaaggtgctgatgattatcgttacttcccagagccagatctcgttccgttatatatc
gatgacgaatggaagaatgcagtaagagaaacaatcccagtgttacctgatgaacgaaaa
gataaatacattaacgaactaggattaccagcatacgatgctaaagtattgacgttaacg
aaagaaatgtctgatttctttgatgaaatggtagcgctcggtgcaaatgcgaagagtgca
tcgaattacttaatgggtaatgtgaatgaatacttgaataaagagcaaatggaattagtt
aattctaacattaaaccaagcaatttagtcgaattgttacagcttgttgatgatcaagcg
atttcaagtaagcaagcgaagaaagtattccaagaaactgctaagtctggggattctcct
aaaaagatcgtaaaagatttaggaatggagcaaatttcggatgttgggacattgactcaa
tttgtaacagaggctttagatgaaaatcctcaatcaatcgaagatttcaaaaatggtaaa
gataaagcgatagggttcttagtgggtcaaattatgaagaaatcaaaaggacaagcaaac
ccaccgttagtgaataaaattttaatggaagaaatcaacaaacgttag

DBGET integrated database retrieval system