KEGG   Auricoccus indicus: BVH56_02495Help
Entry
BVH56_02495       CDS       T04690                                 

Definition
(GenBank) hypothetical protein
  KO
K02250  competence protein ComK
Organism
sbac  Auricoccus indicus
Pathway
sbac02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BVH56_02495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbac03000]
    BVH56_02495
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbac02044]
    BVH56_02495
Transcription factors [BR:sbac03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BVH56_02495
Secretion system [BR:sbac02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BVH56_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK CactinC_cactus
Motif
Other DBs
NCBI-ProteinID: AQL55865
UniProt: A0A1Q1G0I5
LinkDB All DBs
Position
448569..449168
Genome map
AA seq 199 aa AA seqDB search
MMFNYTINFNTMCVIPATQGNITRLCTVHELNGEKVTVAATTQEVIHHACEHYSYSYDAR
KHFSTHLIDVTHKPPLLIDLYGKLLFFPTLSDRNKEVAWFNLSYIESYHETYNDTVLVKF
KNGEKVELPLSLHIFNKQYLLATKLYFKFNQYIKNLDESYQSNSGHNISKAGNPFYQLHH
DNYMNFLAERDNQRQFQLK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttaactacacaattaatttcaacacgatgtgtgtcattccagcaacgcaaggt
aatattacgagactatgcactgtccatgaattaaatggagagaaagtaactgtcgctgca
acaactcaagaggtcattcatcacgcatgcgaacattacagttattcttatgatgcaaga
aagcatttctcaacccatttaattgatgtgacacataaacccccattattaatagattta
tacggtaaattattattttttccaacattatcagatcgtaataaggaagttgcatggttc
aacttatcctacattgagtcatatcatgaaacatataacgatacagtgcttgtgaagttt
aagaatggtgaaaaagtagaattaccattgtctttacatatttttaataagcaatattta
ctggcaacaaagttatattttaagtttaatcagtacattaaaaatttagatgaatcctac
caatccaattcaggtcataatatatccaaggcaggcaatcctttttaccaattacatcat
gacaactacatgaactttttagcagaacgagataatcaacgacaatttcaactgaaataa

DBGET integrated database retrieval system